KEGG   Trichoplax adhaerens: TRIADDRAFT_50031Help
Entry
TRIADDRAFT_50031  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TRIADDRAFT_50031
Enzymes [BR:tad01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TRIADDRAFT_50031
DNA repair and recombination proteins [BR:tad03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     TRIADDRAFT_50031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT_2 BRCT mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 6751687
NCBI-ProteinID: XP_002111010
JGI: 50031
UniProt: B3RS92
LinkDB All DBs
AA seq 924 aa AA seqDB search
MATKTVADEVPFFDLCTLLERISQASGKEKKKKIYSDFLSSWRTAHFKLYGKSSTEDSFF
SAMRLLLPQMDKERLAYGMKETALAKYYIDILSISKESPAAQKLMNYRAPAAAKQDAGDF
ASVAFFVLRTRCPEKGTLSIADVNECLDNIAMANSQRKRDDVRNNLRKLLRNTCAMEQKW
LIRMIMKELKVGLSENSIFSVFHPDASDLFNVSSSLSKVCSDLMDPDVRLNETSIELFVP
FRPMLAERCPLQQVEKLMNHEMFYIECKADGDRMQLHKDGNKYMYFSRSSKEYTSSFGAT
PDEGSFTPFIVNVFSSQVQSAILDGEMVGYDMENDCYVPRGENIDVKAVGRTSAIIQQCY
MVFDILMLNGKKLANHSLHERLGYLKQVFTPIPGRIMVVKQRQATSKKDVLDSLNEAIDT
REEGIIIKNPISTYKPDQRKGSGWFKIKPEYVDSLSDQLDLLIIGGYFGVGRRGGLISHF
LLGVAVPPENPSEHPKVFQSFCKVGSGYTIAELKELGEKLKPYWKPMNPKKLPPYFQLMS
EKPDLWIEPIHSKIVQIKAAEIVPSTDKFKCNCTLRYPRVELVREDKYWYECMDLDELDQ
LKSIAEGRLAYQHADETSETLMFGPSKKRQKANIRPETVCTIAPQFRTADISDVSQVFSG
KEFCVVSGPKHNPKASVEKRIVENGGTFVQNPGMETFCVITDRKTIRARNIISQNIYDVV
KVDWLLDSLAAGRCLEWQPNQVIHSSPKTAEVFAKEYDKYGDSYTKDIDNPVALKAIFDK
INNEDDLVSTATQKEICDVEMRYFPDESPLGLFRRCRAYFDWYRQVDNDATRIRDSPLDL
IGLNFRYYGGTISSILDRHVTHIVFDPSDLSRMQKLRKLDKNRKLLRHFVGSEWVTASID
AASQLSERNYEPLMPRDNSSDSEY
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaaaccgttgcagacgaagttcctttcttcgatctgtgcacattactggag
cgtattagtcaagccagcggcaaggagaaaaagaaaaaaatttattccgattttcttagc
tcttggaggacagctcatttcaaactgtatggaaagtcatccacggaagatagctttttt
tctgcaatgagattattattaccacaaatggataaagagcgcttagcatacggcatgaag
gaaactgctttagctaaatattacattgatatcttgagtatcagtaaggaaagcccagct
gctcaaaagctgatgaattatcgtgcaccagcagctgccaagcaagatgcaggcgatttt
gcaagcgtcgctttctttgttctgagaacaagatgcccagagaaaggaactttatctatt
gccgatgtaaacgagtgtttagacaatatagctatggctaattcacaaagaaagcgagat
gatgtcagaaataatctacgaaagttgttacggaatacatgtgctatggaacaaaaatgg
cttattagaatgattatgaaagagttaaaagtaggccttagcgagaattctattttcagc
gtttttcatcccgacgcctccgatctgttcaacgttagcagcagcttatcaaaggtatgc
tccgaccttatggatcctgacgtgagacttaatgaaacctcaatagagctattcgtacca
tttcgtcctatgttagctgaaagatgccctttgcaacaagttgaaaaactaatgaaccat
gaaatgttttatatagaatgcaaagcagatggagatagaatgcagctgcataaggacgga
aataaatacatgtatttttctagaagttctaaagaatacacttcttcatttggagcaacg
cctgatgaaggatcctttaccccatttatcgtaaacgtttttagtagtcaagttcaatct
gccattctagatggcgagatggttggttacgatatggaaaatgactgttatgttcctcgt
ggtgagaatatcgatgtcaaagcagtaggcagaacgtcagctattatacaacaatgctat
atggtatttgatattttaatgttgaacggtaaaaaattagcaaaccattccttgcatgaa
cgactcggatacttaaagcaagtattcactcctatacctggtcgaatcatggtagtcaaa
caacggcaagctacaagtaaaaaagatgttttagactcacttaatgaagcaatagatact
agggaagaaggcatcatcataaaaaacccaatttccacttacaagccggatcagagaaaa
ggcagtggatggtttaaaattaagccagaatatgtagatagcttgagcgatcaattggat
ctattaataattggaggctactttggcgttggccgacgtggtggcctaatttctcacttt
ttacttggggtagctgtacctccggaaaatcctagtgaacaccctaaagtatttcaatct
ttctgcaaggtggggtcaggatatactattgctgaattaaaagagcttggagagaaatta
aaaccctattggaaacccatgaatcctaagaaacttccaccatactttcaattgatgtct
gaaaagccagacttatggatagaaccgattcattctaagattgtacaaatcaaagcagcc
gaaattgtaccttcaactgacaaatttaaatgcaattgtaccttgcggtacccaagggta
gaacttgttagagaagacaaatattggtatgaatgcatggatctagatgaactggatcaa
ctaaaatctattgcagaaggaagattggcgtaccaacatgcagacgaaaccagcgaaaca
ttaatgtttgggccttccaaaaaaaggcaaaaagcaaatattcgacctgaaactgtttgc
acaattgctcctcaatttcgaacggcagatattagtgacgtctcacaagtattttcgggt
aaagaattttgtgtagtgagtggaccgaaacacaatccaaaagcctcagttgaaaagcga
attgtagaaaacggtggtacatttgtgcaaaatccaggaatggaaacattttgtgttata
actgatcgtaaaacgatacgtgctcgaaatatcattagccaaaatatttatgatgtcgta
aaagttgattggctgttagattcattggctgcaggtagatgcctagaatggcaacctaat
caagtaattcacagttcgcctaaaactgcagaagttttcgcgaaagaatacgataaatac
ggagatagttacactaaagatattgacaaccctgtcgctttaaaagcgatcttcgataaa
attaacaatgaggatgatttagtaagtactgcaacacaaaaagaaatttgcgatgtagag
atgaggtacttccctgacgaatctcccctaggactctttagaagatgcagggcttacttc
gattggtatcgtcaagttgacaatgacgcgacccgcatacgagatagtcccctagacttg
attggacttaatttcagatattatggaggaactatatctagcattttagatcgtcatgtt
actcatatcgtgtttgatccaagcgatttatctcgaatgcaaaaactgcgaaagttagac
aaaaacagaaagttattacgtcacttcgtcggctcagagtgggtgacagcttcgattgat
gccgcttctcaattaagtgaaagaaattatgagccattaatgcctcgagataattcaagt
gactctgaatattga

DBGET integrated database retrieval system