KEGG   Trichoplax adhaerens: TRIADDRAFT_53251Help
Entry
TRIADDRAFT_53251  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
tad  Trichoplax adhaerens
Pathway
tad00310  Lysine degradation
tad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    TRIADDRAFT_53251
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tad03036]
    TRIADDRAFT_53251
Enzymes [BR:tad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     TRIADDRAFT_53251
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     TRIADDRAFT_53251
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     TRIADDRAFT_53251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF4071 TPR_12 UVR
Motif
Other DBs
NCBI-GeneID: 6751103
NCBI-ProteinID: XP_002109888
JGI: 53251
UniProt: B3RNQ6
LinkDB All DBs
AA seq 448 aa AA seqDB search
MAYFQSWSDNVEIFETYEKGRGIRCKKQLAIGTSVGKENPFCHVVSQDMLSSYCHSCLLM
QSELYKCSRCKIIMYCCKSCQKEDWQWHKYECKSITRLGPKVPPDSIRLLGRVAYTILQG
QDRADQFKFLLSNRELLEGSRKNTIVDGINLLKEYLSNKVAINENEIIEIISRVTCNTFT
ICNSEMQTVGIGVYPGLSLVNHSCSPNCSATFRGKQMQLRIIENTKIGDELLISYIDPMQ
VLSSRQNQLQSQYCFKCICERCIDTTKDSCNNLMDSVRCPKKICKAASSLDSLLANKLCP
ECGSIVDQSFFAEIENFQAQINKTISLGYQQAKLEDLKKLFIEGKQRLGECNMLYIRIIE
NLMDAYIESQRYEEALEYARRLEEPYCRLYPRYYPVTGVHLMKQGKLECYLGKFGEAVKS
LGKAKEILLVSHGKECGLIHEMNEMVSI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcttacttccaatcttggagtgataacgtggaaatttttgaaacatacgagaaagga
cgagggataagatgcaagaagcaattagcgattggaacctcagtaggcaaggagaaccca
ttttgtcatgtcgttagccaagatatgctatcgagttattgccattcttgtcttttaatg
caatcagaattatataaatgtagcaggtgcaaaatcatcatgtattgctgtaaaagttgt
cagaaggaagattggcaatggcataaatatgagtgcaaatcaattacgcgtcttggccct
aaagtcccacctgatagtattcgattgttaggtcgggttgcttatacaattttacaagga
caagatcgagcagaccaatttaaatttttattatctaatagagaactactagaaggaagc
aggaaaaataccattgttgatggtattaatttattaaaagagtacttatcaaataaagtt
gccataaacgaaaatgaaattattgaaattattagtagggtaacttgcaatacctttaca
atatgcaactcagagatgcaaactgttggaattggagtttatccggggttatcactagta
aatcattcgtgctctccaaactgttctgccacctttcgaggaaagcaaatgcaactacgc
atcatcgaaaacactaaaataggagatgagctgcttattagttatattgatccaatgcaa
gttctcagtagcagacaaaatcagcttcaatcacaatattgttttaagtgtatttgcgag
agatgtatagatactaccaaggattcctgtaataatttaatggattcagtgcgttgccca
aagaagatatgcaaagctgctagttctttagattcgctacttgctaacaaattatgccct
gaatgtggatctatcgtcgatcagtcattttttgccgaaatcgaaaattttcaggctcaa
attaataagactatcagtctaggttatcaacaagcgaaattagaagatttaaagaaattg
ttcatcgaaggaaagcaacgcctaggagaatgtaatatgttatatattcgcatcattgaa
aatttaatggatgcttacatagaatcacaacgttatgaggaagctctagaatatgcaaga
agactagaggaaccttattgcagattatatcctcgctattatccggtaactggagttcat
cttatgaagcaaggaaagttagaatgttatttgggtaaatttggagaagctgtaaagtct
ctaggaaaggcaaaggaaattttacttgtttcgcatggtaaagaatgtggtctcatccat
gaaatgaatgagatggtttctatttaa

DBGET integrated database retrieval system