KEGG   Trichoplax adhaerens: TRIADDRAFT_56899
Entry
TRIADDRAFT_56899  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K09850  Ras association domain-containing protein 1
Organism
tad  Trichoplax adhaerens
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 UTP15_C Ras_bdg_2
Other DBs
NCBI-GeneID: 6754304
NCBI-ProteinID: XP_002113091
JGI: 56899
UniProt: B3RWW2
LinkDB
AA seq 360 aa
MLDRRKQQKQHENQLSVFETIFHRQKLRKSSKSKKDKKYPPLLDRSKSIPGPSFVIDQDE
DTIESYHDFRIVQLTNPTWCDYCTDFIWGLFKQAIRIDLKCPRSLAKQISENHQHIVQQE
QSLQLISGKANEKPGYARNTLEVLGLKSTQELKEVIQRYNQKSSGLIITMQPKSCKFAGF
IHIGVDILRPVNVHPFNGKIKEQLKDSPKLGSSNVNRKRSTSFFMPSGSLQAIHVTSDTT
ATEIIVTFLEKYKIADNPQKFAIYERVHKLTKYFDRKLNDYERPLCLKLMWNKQNDEEKS
FVIGENKTGDICWDAFSVAELENFLTILNLEEKEHINQVRTRYERQENYLRSMLETPKQD
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcttgatcgacgtaagcagcagaaacaacatgaaaaccaattatctgtctttgaaaca
atctttcatcgtcagaaattacgtaaaagtagtaaatctaagaaagacaaaaaatatcct
ccactattagatcgttccaaatcgatccctggccctagcttcgttattgatcaggacgaa
gataccattgaaagctatcacgatttccggattgtacaactaaccaatccaacttggtgt
gattattgcactgattttatttggggcttattcaagcaagcaatcaggattgatttgaaa
tgtcctcgatcgttggctaaacagatatcagaaaatcaccagcatatagtacaacaggaa
caatccctacaactaattagcggaaaggccaacgaaaagccaggatacgcacggaatact
ttagaagtattggggttaaaatctacacaagaactgaaagaagttatacaaagatacaat
cagaaatcttctggtttaatcattaccatgcaaccaaagagctgcaagttcgctgggttt
attcatattggcgtcgatattcttcgaccagtaaatgttcatcctttcaatggtaaaata
aaagaacagctgaaagattcgcctaagcttggttctagtaacgttaataggaaacgaagt
acatctttctttatgccgagtggtagtttacaggctattcatgttacgagtgatacaacc
gcaacggaaattatcgttacctttttagaaaagtataaaattgctgataatccacaaaag
tttgcaatctatgaaagggtgcacaagcttaccaagtactttgatagaaagctgaatgac
tacgaaagacctttatgccttaaattaatgtggaataaacagaacgacgaagagaaatcg
tttgttatcggtgaaaataaaactggagatatttgttgggatgcattttcagtagcggag
ctggaaaattttttgactatcttaaatttagaagagaaagagcatattaatcaggttcgt
acacgatatgaaaggcaagaaaattatttgcgaagtatgcttgaaactccaaaacaagat
taa

DBGET integrated database retrieval system