KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0127Help
Entry
TepiRe1_0127      CDS       T02434                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00473  D-Alanine metabolism
tae00550  Peptidoglycan biosynthesis
tae01100  Metabolic pathways
tae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TepiRe1_0127
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TepiRe1_0127
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    TepiRe1_0127
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tae01011]
    TepiRe1_0127
Enzymes [BR:tae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TepiRe1_0127
Peptidoglycan biosynthesis and degradation proteins [BR:tae01011]
 Precursor biosynthesis
  Amino acid ligase
   TepiRe1_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 RimK ATP-grasp_4 Ins134_P3_kin ATPgrasp_Ter ATPgrasp_ST CPSase_L_D2 Dala_Dala_lig_N GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CDI40295
UniProt: U4Q7S0
LinkDB All DBs
Position
130001..130957
Genome map
AA seq 318 aa AA seqDB search
MKIAILIDEPRVSYLPGEEGLNEDLQKRKTVKNLKEVLSKRFECSLVKADSDIISKLQNE
NVSLVFNLCNGIRGETRQAQIPAILEFSGIPYTGSSILGHTLAINKNYACKVFKGSGVTT
PEFISIYDKDDLMQLRNKEIKFPVLVKPCDEGSGRGIHQDSLVYDFRSLKRKVQQELRLY
NPPIMVTEYIKGREFTVGILGNGNNLKVLPILEISFEALPDDLAKFYSFEVKANYADKTI
FRCPAPLDNKLKTKIENTAKKAYNALSLRDYARVDVRVKDDTPYVLEVNSLPGLQKGYSD
ITKMASACNLAMKALSLK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctatattaatagacgaaccgcgagtttcttatcttcccggagaagaaggt
ctaaatgaggatctgcaaaagcgcaaaactgtcaaaaatctaaaagaagtgctttcaaaa
cgatttgaatgttcattagtaaaagctgacagtgacattatatccaaattgcaaaatgaa
aatgtaagcctagtatttaatctttgtaatggcattagaggagaaacaagacaggcacaa
atcccggctattctcgaattttcaggcattccttatactggctcatccatactagggcat
acccttgctatcaataaaaattatgcttgtaaagtatttaaaggctctggcgtcacaact
ccggagtttatttctatctacgataaggatgacctaatgcagctcagaaataaagaaatc
aaatttcctgtcctcgtaaaaccttgtgacgaaggttcagggagaggcattcatcaagac
agtttagtttatgattttcgttcgctaaaaagaaaggttcagcaagaactaagattatat
aatccgccgattatggtaacggaatatatcaaggggcgcgagtttaccgttggcatatta
ggtaatggcaataacttgaaagtactgcctatactcgaaataagcttcgaagctcttccc
gatgacttagctaagttttatagttttgaagtcaaagcgaattatgcggataagactatt
tttcgatgtcctgcaccgctggacaataagctcaaaactaaaatagaaaacactgcaaaa
aaagcctacaatgctctaagcttaagagattatgccagagttgacgtaagagtaaaagac
gatactccatatgtccttgaggttaattcattaccaggcctgcaaaaaggctatagcgat
atcaccaaaatggccagtgcctgcaatctagctatgaaggccttatccttaaaatag

DBGET integrated database retrieval system