KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0453Help
Entry
TepiRe1_0453      CDS       T02434                                 

Definition
(GenBank) L-aspartate oxidase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00020  Citrate cycle (TCA cycle)
tae00190  Oxidative phosphorylation
tae00650  Butanoate metabolism
tae01100  Metabolic pathways
tae01110  Biosynthesis of secondary metabolites
tae01120  Microbial metabolism in diverse environments
tae01130  Biosynthesis of antibiotics
tae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TepiRe1_0453
   00650 Butanoate metabolism
    TepiRe1_0453
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TepiRe1_0453
Enzymes [BR:tae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TepiRe1_0453
    1.3.5.4  fumarate reductase (quinol)
     TepiRe1_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_oxidored HI0933_like NAD_binding_8 DAO Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CCP25131
UniProt: F4LUP2
LinkDB All DBs
Position
445371..446879
Genome map
AA seq 502 aa AA seqDB search
MLQIMNIGITDVAVIGGGLAAMYAALEASNYDKSVVIISKKPVGRSGASVISKSVHRFPP
DHLKEKLSYKNKIIEAGRYINNRDLVDTFVEHASQKMDNIEKLKVGLNFKEKLIDGKNHK
YFAACKPKMGKHLTIPLSNIIKTKDNINIMEGYMAVQIVIERDTVCGILIENKNRLYFLG
AKAVVIATGGGGYNYIQTSNTNDLTGDGYAMALRAGLPLIDMEFIQFYPYRTVYPFQHDI
FPDIFSHGAKYLNEKGERFMDKYPKKELENRDILSREMFFQKEIYLNIEDCDKDFMKEEC
DDLYDNYLKYKGEQIKVSPVAHFMMGGVKINADTSTDVRGLFCCGEVAGGLHGANRLAGH
ALTETVVFGHIAGEESAHYAGSKTKISVNFVKEETANWVPNIGEESPTNIKNILRRNMWE
SAGIVRNEDDLQRAKDKVEELEQQIKNLKPLKLRDWIECQNMIQTSKMIIDSCILRKESR
GAHYRSDFPEEDINWQRNIIIN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaataatgaatataggaattacagatgtagcagtaataggtggtgggcttgca
gccatgtatgcagctttggaagcaagcaactatgataaatccgtagtcattatatcaaaa
aaacctgtgggtagatccggtgcttctgttatttctaaatcggttcataggtttccccct
gaccatttaaaggagaagctttcatataaaaataagattattgaggctggcagatatatt
aataatagggatttagtagatactttcgtagagcatgcctcacaaaaaatggataatatt
gaaaagttaaaagtcggattgaactttaaagaaaaacttatagatggcaagaatcataaa
tattttgctgcatgcaagcctaagatgggcaaacatcttactataccgctttcgaacatt
ataaaaactaaagacaacataaatataatggaaggatacatggcagttcagatagtaata
gaaagagatactgtctgcggaattttaatagaaaataagaatcgcctatattttctcggt
gcaaaagctgtggtaattgcgacaggtggaggaggatataattacatccaaactagcaat
accaatgacttaaccggggacgggtatgctatggccttaagagctggcttgcctttgata
gatatggagtttattcagttctacccatatagaacagtatatccctttcaacacgatatt
ttcccagatatttttagccatggggctaaatacttaaacgaaaaaggcgaaagatttatg
gataagtatcccaaaaaggagctggagaacagagatattttatctcgtgaaatgtttttt
caaaaggaaatatatcttaatatagaggattgcgacaaggattttatgaaagaagaatgt
gatgacttatacgacaattatttaaaatataaaggtgagcaaatcaaagtttcacctgtt
gctcattttatgatgggcggcgttaaaataaatgcagatacatctacagatgtaagagga
ttattctgttgcggagaagtagccggaggtttacatggagcaaatcggttagcggggcat
gcccttactgaaactgtagtatttggtcatattgcaggagaggaatccgctcattatgct
ggaagcaaaacaaagatttctgtaaactttgttaaagaagaaactgctaattgggttcct
aatataggcgaggagagtccaacgaatataaaaaatatattaagaagaaatatgtgggaa
tcagcaggaattgttaggaatgaagatgatctgcaacgagcaaaagataaagtagaagaa
ctagaacaacaaataaaaaacttaaaacctctaaaattgagagattggattgaatgccaa
aatatgatccagacctcaaaaatgataatagattcttgtattttaagaaaagagagtaga
ggagcacactatagatctgactttcctgaagaagatattaattggcagcggaatataata
ataaactaa

DBGET integrated database retrieval system