KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0691
Entry
TepiRe1_0691      CDS       T02434                                 

Definition
(GenBank) conserved protein of unknown function
Organism
tae  Tepidanaerobacter acetatoxydans Re1
SSDB
Motif
Pfam: Crescentin ATG16
Other DBs
NCBI-ProteinID: CDI40453
UniProt: F4LW47
LinkDB
Position
686365..687903
AA seq 512 aa
MNTIFPTEDEGLYFNKNLKDLLNERLKPSLVSGYSKSSVQQFVEELYKSSEQMKVSLEKQ
IQDLLGEKAALSQECNILRQQLSEAEKKSIQQKHELDAYLESRNEDTGKIENQLSQLKSE
NYNLSLQLSQAQEAQKLYHSLEAKLADKEKELAEKESQLSELSQQLSASMQRIKMLEEQV
NVLNQQKDANSKAIERTEEIEQMSAEIKALKKQESELNNRIALEQEKAFAAEKTAKEATM
KLESMMSRLSTLEKQETEFNERIAAEQQRAAVAEEAAKEATKKLEFLQSQLEQKQTQIHD
LEEKYRELQKAQEALEQKYDTLHRNYTSTVQKNDTLSAEKEALSDLLQKYQRKEQKYALL
QKQNEEYRKSIFAFDAAIKLLLQEMENQMQLFQNTVDQYHEGEAQIHDLVQEKTQLQIKN
VDLLDQISVLTANLSKAEQECKRLTRMIRFSKNDADITQEDLDDDFEEAQVFDLKTTADG
TDEFVANAVKKAKEISKIYTLDKQAEVHSSAK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaataccatatttcccactgaagatgaaggattgtacttcaataaaaacttgaaagat
ttgctaaacgagcgtttaaagccttctttagtcagcggttattctaaaagcagcgttcaa
cagtttgtggaagaattatataaatcttcggaacaaatgaaggttagcttggaaaagcaa
attcaggatttgctgggtgagaaagctgcactttctcaagaatgcaatatactcaggcaa
cagctttcggaggcagagaaaaagtctatacagcaaaaacatgaattggatgcctattta
gagtctcgtaatgaagatacaggaaaaattgaaaatcaattatcacaactcaaatcagag
aactataacttgagccttcaattatctcaagcgcaagaagctcagaagctttatcattca
ttagaggcaaaattagctgataaagagaaagaacttgctgaaaaggaatctcagttatcc
gagttgtctcaacaattatctgctagcatgcagcggattaaaatgttggaagaacaggtt
aatgtattgaatcagcaaaaagatgcaaattcaaaagcaattgaaagaacagaagaaata
gaacaaatgtctgccgaaatcaaagcacttaaaaaacaagagtctgaattaaataacagg
atagctttagagcaggaaaaagcctttgctgctgaaaaaacagcaaaggaagcgacgatg
aagcttgagtcaatgatgtcgcggttatcaactcttgaaaagcaggagacagaatttaac
gaaaggattgcggcagagcaacaaagggctgccgttgccgaagaagcagcaaaagaagca
acaaaaaaactcgaatttctacaatcacagctagaacagaaacaaacacaaattcatgat
ttggaagaaaaatatcgtgaacttcaaaaagcacaagaagcattagaacaaaaatatgat
acattacaccgcaattacacatctactgttcaaaaaaatgatacactttccgctgaaaag
gaagctctttctgacttgctccaaaagtatcaaaggaaggagcagaaatatgcgctattg
cagaaacaaaatgaggagtatcgcaaatctatctttgcatttgacgcggcaataaagctg
cttttacaggaaatggaaaatcagatgcaactttttcaaaatactgttgatcaatatcat
gaaggtgaagctcaaattcatgatttagtacaagagaaaacacagcttcaaataaagaat
gttgatctactggatcagattagcgttcttacggcaaatttatcaaaagcagaacaagaa
tgtaaacgtcttactagaatgattcgtttttcaaaaaatgatgctgacatcacgcaggaa
gacttagacgatgactttgaagaggctcaagtttttgacttgaaaactactgcagacggc
acagatgaatttgtagctaatgccgttaaaaaagcaaaggaaataagcaagatttacact
ttggacaaacaggctgaagtacattcttcagcaaagtga

DBGET integrated database retrieval system