KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_1798Help
Entry
TepiRe1_1798      CDS       T02434                                 

Definition
(GenBank) putative transketolase N-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00030  Pentose phosphate pathway
tae01100  Metabolic pathways
tae01110  Biosynthesis of secondary metabolites
tae01120  Microbial metabolism in diverse environments
tae01130  Biosynthesis of antibiotics
tae01200  Carbon metabolism
tae01230  Biosynthesis of amino acids
Module
tae_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TepiRe1_1798
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    TepiRe1_1798
Enzymes [BR:tae01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     TepiRe1_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-ProteinID: CCP26597
UniProt: F4LWT4
LinkDB All DBs
Position
complement(1720954..1721775)
Genome map
AA seq 273 aa AA seqDB search
MSISCETINELNSKARIIRRHIVEMIAEAGSGHPGGSLSSADIVTALYFHVMNVDPQNPH
WPERDRFVLSKGHAAPLLYAVLAEKGFFPKEELLTLRKTGSMLQGHPDMKSTPGLDMTTG
SLGQGLSAANGMALAAKLDKKSYRVYVVMGDGELEEGQIWEAAMTSAHYKLDNLTAFVDH
NGLQIDGPIQKVMSPENIHEKFKAFGWNVIDIDGHDMKQILEAVEEAKTVKSRPTVVVAK
TVKGKGVPFMENQVGWHGKAPSPEQVKEALNSI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtatatcttgtgaaactatcaatgaacttaactctaaagcacgtattattcgccgc
catattgtcgaaatgattgctgaagcgggttcgggtcatcccggtgggtcattatcaagt
gcagatattgttactgcactgtactttcatgtaatgaatgtagaccctcaaaatcctcat
tggccggaaagagataggtttgtcttatctaaaggccatgcggctccgcttctatatgca
gtcttggcagaaaagggatttttcccaaaagaagaactactaaccctcagaaagacaggt
tccatgcttcaagggcatcctgacatgaaatcaactccgggcctagacatgactacaggc
tctttaggtcaaggcttatcagctgcaaacggtatggcacttgcggcaaaattggataaa
aaatcctatagggtatatgtagttatgggcgatggtgagcttgaagaaggtcagatttgg
gaagcagccatgacttcagcacattacaaattagataatttgacggcttttgtggaccat
aacggtttacaaatagatggtcctattcaaaaagtaatgtcgccggaaaacatacatgag
aagtttaaagcttttggttggaatgtaatcgatatagacgggcatgatatgaagcagatt
cttgaggctgttgaggaagctaagaccgtaaaaagcagaccgactgtcgtagttgcgaaa
acagtaaaaggtaagggcgtgccttttatggaaaatcaggtaggttggcacgggaaagct
ccctctcctgaacaggtaaaagaggctttgaattctatataa

DBGET integrated database retrieval system