Candidatus Nitrosotenuis cloacae: SU86_003415 Help Entry SU86_003415       CDS       T03883                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tah  Candidatus Nitrosotenuis cloacae Pathway tah03010   Ribosome Brite KEGG Orthology (KO) [BR:tah00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SU86_003415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tah03011]     SU86_003415    04121 Ubiquitin system [BR:tah04121]     SU86_003415   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tah04147]     SU86_003415 Ribosome [BR:tah03011]  Ribosomal proteins   Eukaryotes    Small subunit     SU86_003415   Archaea     SU86_003415 Ubiquitin system [BR:tah04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SU86_003415 Exosome [BR:tah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SU86_003415   Exosomal proteins of colorectal cancer cells    SU86_003415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e DUF1451 Nudix_N_2 GFA Motif Other DBs NCBI-ProteinID:  AJZ75578 UniProt:  A0A3G1B4A8 LinkDB All DBs Position 1134679..1134858 Genome browser AA seq 59 aa AA seqDB search MADKKAKAKATGIASYYKISGDKATRVHKSCSRCGKGVFMSDHKNRKTCGKCGLTEFIQ NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atggcagacaaaaaggcaaaagcaaaggcaaccggcattgcatcatactataaaatttct ggcgacaaggcaacccgagtacacaagtcctgctccaggtgtggcaagggcgtattcatg tcggatcacaaaaacagaaagacctgcggcaagtgcggcctaactgaattcattcagtag

DBGET integrated database retrieval system