KEGG   Thermanaerovibrio acidaminovorans: Taci_1132Help
Entry
Taci_1132         CDS       T01129                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00473  D-Alanine metabolism
tai01100  Metabolic pathways
tai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tai00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Taci_1132
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Taci_1132
Enzymes [BR:tai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Taci_1132
Peptidoglycan biosynthesis and degradation proteins [BR:tai01011]
 Precursor biosynthesis
  Racemase
   Taci_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 8630980
NCBI-ProteinID: YP_003317646
UniProt: D1B5S3
LinkDB All DBs
Position
complement(1189034..1190176)
Genome map
AA seq 380 aa AA seqDB search
MLRPTRMEVSLRAVRHNLDQIRSYVGGRAQVMGVVKANAYGLGARRVVEALRAQGVVRFA
VATPDEAVQLREWGVGEPVLVLGQCLPSAAGEMVAMDVTCAVGSLELARALSAEAERQGR
QVKVHIKVDTGMGRIGFLPGELEAAMDQILSMRHLDVEGIFTHFATADEARLDHAEEQLR
RFGDALDRMRCRGVRFRLRHACNSAATIRMPHGHLDAVRPGIILYGMRPSPLCPMPLNLE
VPFEVNTAVAAVRELPPMWGISYGMRYVTRGNERIAVLPIGYRDGYARALSGKAQVLIRG
RRFPVVGTICMDQCMVDVTDCPSVQVGDPVVLLGRQGDQAITPEEFASWLNTIVYEVPGM
FSERVPRVYVDREGEGPGEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctcagacctacccggatggaggtcagcctccgggcggtgaggcacaacctggatcag
atacgctcctacgttggtggcagggcccaggtcatgggggtggtgaaggccaacgcctac
ggcctgggtgcccggcgggtggtggaggccctgagggcccagggggttgtgcggtttgcg
gtggcgaccccggacgaggcggtgcagcttcgggagtggggagtgggtgagcctgtgctg
gtgctggggcagtgcctgccctccgccgcgggggagatggtggccatggacgtgacctgc
gcggttgggagcctagagctggcccgggcgctgagcgccgaggcggagcgccaggggcgg
caggtcaaggtgcacatcaaggtggacaccggcatggggaggataggtttcctccccggg
gagctggaggccgccatggatcagatcctgtcaatgcggcatctggacgtggaggggatc
ttcacccacttcgccaccgccgacgaggcccggctggaccacgcggaggaacagcttaga
cgcttcggggacgccctggaccggatgcgttgccggggggtcaggttcaggctgaggcac
gcctgcaacagcgccgccaccataaggatgccccacgggcacctggacgcggtgaggccc
ggcatcatcctctacgggatgcgcccctcccccctgtgccccatgccgttgaacttggag
gtccccttcgaggttaataccgcggtggcggcggtcagggagctcccccccatgtggggg
atcagctacgggatgaggtacgtaacccgggggaacgagaggatagcggtgctcccaata
ggctaccgggatggctacgccagggccctgtccggcaaggctcaggtgctcatccgtggc
aggcgcttcccggtggtgggcaccatatgcatggaccagtgcatggtggacgtgaccgac
tgcccgtcggtccaggtgggggatccggtggtcctcctgggccgccagggggaccaggcc
ataacccccgaggagttcgcctcctggctcaacaccatcgtctacgaggtgccgggcatg
ttctccgagagggtccccagggtctacgtggatcgggagggggaggggcctggggaggga
tga

DBGET integrated database retrieval system