KEGG   Tamlana sp. UJ94: C1A40_04520Help
Entry
C1A40_04520       CDS       T05295                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
taj  Tamlana sp. UJ94
Pathway
taj00620  Pyruvate metabolism
taj00680  Methane metabolism
taj01100  Metabolic pathways
taj01120  Microbial metabolism in diverse environments
taj01200  Carbon metabolism
Module
taj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:taj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C1A40_04520
  09102 Energy metabolism
   00680 Methane metabolism
    C1A40_04520
Enzymes [BR:taj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C1A40_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUS04783
UniProt: A0A2I7SFU8
LinkDB All DBs
Position
972101..974692
Genome map
AA seq 863 aa AA seqDB search
MSIEPKLTRFNQSVLSKYQIFNSIFMTLPFDAVTKTGVLLPLFHETCKKGFENGDNPTTI
VDTFFEKYQARRNKESQINLLFRFIQYIERQVVLFDAIEDAAFPIVNNMDGVGTLRNLKD
KAQAEYKLDELKAYLDDFKVRIVLTAHPTQFYPGSVLGIITELSKAIEKNNLSEINNLFG
QLGKTPFFKHKKPTPYDEAKSLIWYLENVFYISFGKIYNYIQTNIYADQKKHNEIINIGF
WPGGDRDGNPFVKPETTLKVAKKLKKAILKKYYEDLKKLRKKLTFKGVEDRIINLETILY
DYSINLKSKKAISVKELTEELLSIRKIVVEQHQSLYENEINNLINRIHLFGYRFATLDIR
QDSRIHHSVFTNVVDQLLASGNSCLPENYHDLSEEEQIDILSKTTDEITDLDVFEDEMTF
NTLKTIQVIKQIQKMNGERGANRYIISNNQTALNMMQLFAMLKMVAFKDKLTVDLVPLFE
TIPDLENAPGVMEQLYTNPAYMAHLKSRGNKQTIMLGFSDGTKDGGYLMANWGIYKAKEL
LTEMSRKYGITAIFFDGRGGPPARGGGKTHNFYSSLGPTIEDKEVQLTIQGQTISSNFGT
LNSSQFNLEQLISSGVTNRIGSEKNKLSEEDRAVMTDLAETSYQVYKDFKSHEMFIPYLE
RMSTLKYYAKTNIGSRPSKRGTSDKLVFSDLRAIPFVGSWSQLKQNVPGFYGVGTALKKY
EDRGEFDKVQQLYKNNKFFKTLLENSMMSLTKSFFNLTKYMSNDEEFGAFWNIIHTEYET
TKRLLLKLTGYETLMQNEPTGKASIEVRESIVLPLLTIQQYALKKVQELEKAGVPADDPE
KLIFEKIVTRSLFGNINASRNSA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagagccaaaattaacacgatttaatcaaagcgtcttgtctaaatatcagata
ttcaacagtatcttcatgacattaccctttgatgccgtaaccaaaacaggcgtattactt
ccgctttttcacgaaacttgcaaaaaaggatttgaaaacggcgacaatcccacaacgata
gttgatactttttttgaaaaataccaagcgcgtagaaacaaagaaagtcaaattaaccta
ttgttccgattcattcaatacatcgaaagacaagttgtactgtttgatgcaattgaagat
gctgcctttccaatagtaaacaatatggatggcgtaggaaccctacgtaacttaaaagac
aaagctcaagctgaatacaagttggatgagttaaaagcctatttagacgattttaaggta
cgtatcgttttaacagcccacccaacacagttttacccaggttcggtattaggcattatt
accgaattatctaaagctatagaaaagaataatttatctgaaattaataaccttttcgga
cagttaggtaaaacgcctttctttaagcataaaaaaccaacaccatacgatgaagcaaaa
agcttaatatggtatttagagaatgttttttacatctcgtttggaaaaatttataattac
attcaaacgaatatttatgcggaccaaaagaagcataatgaaattattaacattggtttc
tggccagggggcgaccgtgatggaaatccatttgtaaaacctgaaaccaccttaaaagta
gctaaaaagcttaaaaaggcgattcttaaaaaatactacgaggatcttaagaaattaaga
aaaaaactaacttttaaaggtgttgaagatcgcatcattaacctagaaacgattctttac
gattacagtattaatcttaaaagtaaaaaggcaatttcggtaaaggaattgactgaagaa
cttttaagcattagaaaaatagttgtagaacaacaccaatcgttatatgaaaacgagatt
aacaatttaattaaccgcattcacctttttgggtaccgttttgcaactttagatattaga
caagatagcagaattcaccacagtgtattcacaaatgttgtcgatcaattactagctagc
ggcaactcttgcttaccagaaaattaccatgatttatctgaagaagaacaaatcgatatt
ttatcaaaaactaccgatgaaataaccgatttagatgtttttgaagatgaaatgaccttt
aacaccttaaaaacgatacaggttattaagcaaattcagaaaatgaatggtgaacgtggg
gctaatcgatacattataagtaacaatcagacggcattaaatatgatgcagctttttgct
atgctgaaaatggttgctttcaaagacaaattaaccgttgatttagtaccacttttcgaa
accataccagatttagaaaacgctcctggtgttatggaacagttgtataccaacccagct
tatatggcgcacttaaaatctagaggaaacaaacaaaccattatgcttggtttctctgat
ggtaccaaagacgggggctacttaatggcaaactggggtatttataaagctaaagaattg
ttaaccgaaatgtctagaaaatatggtattaccgccatattctttgacggacgtggtgga
ccaccagcacgtggtggtgggaaaacacataacttctattcttctttaggacctactatt
gaagataaagaagtacaactaaccattcaaggtcaaaccattagttctaatttcggaact
ttaaactcgtcacaattcaacttagaacagttaattagttcgggcgttacaaaccgaatt
ggaagtgaaaagaacaagctttctgaagaagatcgcgctgttatgaccgatttagctgaa
actagctatcaagtttacaaagacttcaagagtcatgagatgtttatcccttacttggag
cgcatgagtaccttaaagtattatgcaaaaactaacattggtagtagaccatccaaacgt
ggtacatcagataagttggtgttctccgatttaagagccattccttttgtaggatcttgg
agccaattaaaacaaaacgttcctggattttacggtgttggaacggcattgaaaaaatac
gaagatcgcggcgagtttgataaggttcaacaactttataaaaacaataagttctttaaa
acgcttctggagaacagtatgatgtccttaacaaagtcattctttaacctgacaaaatac
atgtctaatgatgaagaatttggtgcgttttggaacattatccacaccgaatacgaaacg
acaaaacgtttgcttttaaagcttacaggatatgaaactttaatgcaaaatgagcccact
ggaaaggcctcgattgaagttagagagtctatcgtattaccgttattaacgattcagcaa
tacgcccttaaaaaggttcaggagttagaaaaagcaggagttccagccgatgaccctgaa
aagttaatttttgagaaaattgtaacgcgttcgttattcggaaatattaatgcaagtaga
aattcagcttag

DBGET integrated database retrieval system