KEGG   Tamlana sp. UJ94: C1A40_07285Help
Entry
C1A40_07285       CDS       T05295                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
taj  Tamlana sp. UJ94
Pathway
taj00240  Pyrimidine metabolism
taj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C1A40_07285
Enzymes [BR:taj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C1A40_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AUS05288
UniProt: A0A2I7SHB3
LinkDB All DBs
Position
complement(1626148..1626795)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQIARQKVEIFKPTLDVRYDEDK
VVSHDANEIRSTSVPAAANIPILADGCDVVGIDEAQFFDDEIVHICNDLANKGIRVIVAG
LDMDFKGNPFGPMPHLMATAEYVTKVHAVCTKTGNLAQYSYRKNRNDSLVLLGEVNEYEP
LSRAAYYKAMMRDKVRNMKVNDAEELNNKKNQDDA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagaacaatttgggtggattgaagtgatctgc
ggttctatgttttccggaaagaccgaagaacttatacgccgattaaaacgcgctcaaatt
gccagacaaaaagtagaaatattcaaacctactctggatgttcgttatgatgaggataaa
gtcgtttctcatgacgccaacgaaattcgatctacttctgttcctgctgctgccaacatt
cctattttagccgacggttgtgatgtggtgggtatagacgaagctcaattttttgatgat
gaaattgtacacatttgcaatgacctcgccaacaaaggcatacgggttattgtagctggt
ttggacatggattttaaaggcaatccttttgggcccatgccacatttaatggccactgcc
gaatacgtcactaaagtgcatgctgtttgtacaaaaactggcaatttagcacagtacagt
taccgaaaaaacagaaatgacagcttggttttattaggtgaagttaatgaatatgagcct
ttaagtcgtgcagcatactacaaagccatgatgcgtgataaagtaagaaatatgaaggtg
aatgatgccgaagaattaaacaacaaaaaaaaccaagacgatgcctaa

DBGET integrated database retrieval system