KEGG   Thauera aromatica: Tharo_0642Help
Entry
Tharo_0642        CDS       T05381                                 

Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tak  Thauera aromatica
Pathway
tak00340  Histidine metabolism
tak01100  Metabolic pathways
tak01110  Biosynthesis of secondary metabolites
tak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Tharo_0642
Enzymes [BR:tak01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Tharo_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AVR87584
UniProt: A0A2R4BK53
LinkDB All DBs
Position
653370..653711
Genome map
AA seq 113 aa AA seqDB search
MIDIEVLRRVSDTLVARKQADPDASYVSSLYAKGTDAICKKVAEEAAETIMAAKDQDRLH
LVWEVTDLWFHSLVLLAHHGLSVEDVIAEFRRREGVSGIDEKKSRTAQVEVRG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatatcgaagtgctgcgccgcgtctccgacaccctggtcgcgcgcaagcaggca
gaccccgacgcctcctacgtgtccagcctctacgccaaggggaccgacgcgatctgcaag
aaagtcgccgaagaggccgccgagacgatcatggcggcgaaggaccaggaccgcctgcac
ctggtgtgggaagtgaccgacctgtggttccattcgctggtgctgctggcacaccacggc
ctgtcggtggaggacgtgatcgccgagtttcgccgccgcgaaggcgtatccggcatcgac
gagaagaaatcgcgtaccgcgcaggtggaggtccggggatga

DBGET integrated database retrieval system