KEGG   Thauera aromatica: Tharo_0693Help
Entry
Tharo_0693        CDS       T05381                                 

Definition
(GenBank) TraU-family protein
Organism
tak  Thauera aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraU
Motif
Other DBs
NCBI-ProteinID: AVR87635
UniProt: A0A2R4BJY3
LinkDB All DBs
Position
complement(709770..710717)
Genome map
AA seq 315 aa AA seqDB search
MTRPFERMRRLRAGVVSVLLLSATGSYALNTATIVGSVASPDCLEYRVVGICYWLYCTWT
GCTVRTSIKVRHYIPDAVVSSYSNTGENPWVEVRAMSAPNPSAQAGGDGTTNEDHENNLA
KFKNADVIGHPGVEVFNQFVSSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEAL
IPGRREVGARTTMNLWGNVYPRGGFLHQADDHKAGAVVAQRAGDVVTRRGQIHVYQPLLA
NSRPGYWPAGALMEGDASTGKWQELTPVLSSSCTVFPRSGFLTQAQQGDYAWALWRPYAC
CERRGQVFLGSVDFQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacccttcgagcggatgcgccgcctgcgtgctggcgtggtctcagtgctgctg
ctcagcgccacgggcagctacgccctcaacaccgcaaccatcgttggctcagtggcatcg
ccggactgcctcgaataccgcgtcgtcggcatctgctactggctctactgcacctggacg
ggctgcacggtgcgcacatccatcaaggtccgccactacatccccgatgcggtcgtctcc
agctacagcaacaccggcgagaacccttgggtcgaagtccgggcgatgagcgcgcccaac
ccatccgcgcaggccggcggggacggcaccaccaacgaagaccacgaaaacaatctcgcc
aagttcaagaacgcggacgtcatcggccatcccggcgtcgaggtgttcaaccagttcgtc
tcatcgtcgggctacttctgcgagggcgcgggcacggcgttcatgccgtatctgctcagc
accctggacacactggcctggcgctacaacgtgccggagatggcctacccggaggcacta
attccgggcaggcgcgaggtcggcgcgcgcaccacgatgaacctgtggggcaacgtctat
ccgcgcggcggcttcctgcaccaggccgacgaccacaaggccggcgccgtggtggcccag
cgcgccggcgatgtcgtcacgcgccgtgggcagattcacgtctatcagccgctgctcgcc
aactcgcggcccggttactggcctgccggcgcgctgatggaaggcgatgcctcgacgggc
aagtggcaggaactcacgcccgtcctgtcctcgtcctgcacggtgttcccgcgcagcggc
ttcctgacccaggcgcagcagggcgattacgcctgggcgctgtggcggccctatgcgtgc
tgcgaacgtcgcggccaggtattcctcggcagcgtcgatttccaatga

DBGET integrated database retrieval system