KEGG   Thauera aromatica: Tharo_0817Help
Entry
Tharo_0817        CDS       T05381                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
tak  Thauera aromatica
Pathway
tak00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tharo_0817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tak01002]
    Tharo_0817
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tak01011]
    Tharo_0817
Enzymes [BR:tak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tharo_0817
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Tharo_0817
Peptidases and inhibitors [BR:tak01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Tharo_0817
Peptidoglycan biosynthesis and degradation proteins [BR:tak01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Tharo_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AVR87759
UniProt: A0A2R4BKC9
LinkDB All DBs
Position
complement(837092..838606)
Genome map
AA seq 504 aa AA seqDB search
MPFYLSPTPLRRLLAALVLVLGLAPGLQHRALADGALPPPVALALGAAGIPATAVAVWTQ
PVDGQQPVLTLNAGEPMNPASVMKLVTAFAAFERLGPAHTWRTRIAASGTLRDGVLHGDL
YLVGGADPMLGQERLWKLLRRLRALGIERIAGDIVLDASALRLPPHDPDAFDGRGLRPYN
SGPHGLLLQYNTLLLGLFPGRAANEPVALAAEPPLAGVVIDNRILTSDAPCGLWYGDLQA
RLEAGPRLVLSGSLPAACGPRTWSAAPLPPADFGIALVAGLWAEAGGRVDGRVRAGVLPA
ASRELLGDDSPALAEVVREMNKWSSNVIARQLLATLGAHSAVGGAEAGADLPPATPGDRP
PAPDMVADGARAAAAVAAAAGIDTTGLVIENGSGLSRIERIRADSLGQLLLAAWRRPWMP
EFLAALPLAGVDGTARGRLAASPARGHAHLKTGTLDGVRTMAGYLLDRHGRRHAVVMMVA
HPAAASAAAAQDALLEWLWANGAP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctacttgtcgccgacgcccttgcggcgtctgctcgccgcgctggttctggtt
ctgggtctggcgcccggcctccagcaccgggcgctcgccgacggcgccctgccgccgccg
gtagcgctcgcgctcggcgccgccggcatccccgccacggcggtcgcggtctggacgcag
ccggtcgatgggcagcagcccgtcctcacgctcaacgccggggagccgatgaacccggcc
tcggtaatgaagctggtcaccgccttcgccgccttcgaacggctcggcccggcccacacc
tggcgcacccggatcgccgccagcggcacgctgcgcgacggcgtgttgcacggcgacctc
tacctggtcggcggcgccgacccgatgctcggccaggagcgcctgtggaagctgctgcgc
cggctgcgcgcgctcggcatcgagcgcatcgccggcgacatcgtcctcgacgcctccgcg
ctgcgcctgccgccgcacgaccccgacgccttcgacggccgcggcctgcgcccctacaac
agcggcccgcacggtctgctgctgcagtacaacaccttgctcctcggcctgttcccgggt
cgcgccgccaacgagccggtggcgctcgccgccgaaccaccactcgccggcgtcgtcatc
gacaaccgcatcctgacctcggacgcgccctgcgggctgtggtacggcgatctccaggcc
cgcctcgaagccggcccccgcctggtgctgagcggcagcctgccagccgcctgcgggccc
cgcacatggagcgcggcgccgctgccgccggccgacttcggcatcgccctggtggccggg
ctgtgggccgaagcgggcggccgggtggacggcagggtgcgcgccggagtgctgcccgcc
gccagccgcgaactgctcggcgacgactccccagcgctggccgaagtcgtgcgcgagatg
aacaagtggtcgagcaacgtcatcgcccgccagctcctcgccaccctcggcgcgcacagc
gcggtcggcggcgccgaggcgggcgccgacctccccccggcgacacccggggatcgcccg
ccggcgccggacatggtcgccgacggtgcccgcgcggcggcggccgtggccgccgccgcc
gggatcgacacgaccgggctggtgatcgaaaacggctccggcctgtcgcgcatcgagcgc
atccgcgccgacagtctcggccagctcctgctcgccgcctggcggcggccgtggatgccg
gaattcctcgccgcgctgccgctcgcgggcgtggacggcaccgcccgcggacgcctggcc
gccagcccggcgcgcggccacgcccacctcaagaccggcaccctcgacggcgtccggacg
atggccggctacctgctcgaccgccacggccgccgccacgcggtggtgatgatggtcgcc
caccccgcagccgcgagcgcggccgccgcccaggacgcgctgctcgaatggctgtgggcc
aacggggcgccgtag

DBGET integrated database retrieval system