KEGG   Thauera aromatica: Tharo_0822Help
Entry
Tharo_0822        CDS       T05381                                 

Definition
(GenBank) transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
tak  Thauera aromatica
Pathway
tak00550  Peptidoglycan biosynthesis
tak01100  Metabolic pathways
tak01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tharo_0822
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Tharo_0822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tak01003]
    Tharo_0822
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tak01011]
    Tharo_0822
Enzymes [BR:tak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Tharo_0822
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tharo_0822
Glycosyltransferases [BR:tak01003]
 Polysaccharide
  Bacterial polysaccharide
   Tharo_0822
Peptidoglycan biosynthesis and degradation proteins [BR:tak01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Tharo_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AVR87764
UniProt: A0A2R4BKN3
LinkDB All DBs
Position
complement(840948..843386)
Genome map
AA seq 812 aa AA seqDB search
MRWVLYPVGALFALIILGLATLTAMALFAWPNLPALDTLTDYRPRIPLRVYTADGHLLGE
FGEERRDVVRIAEVPSVLKHAILAAEDERFYEHPGIDLMGLVRAALANLSSGGRSQGAST
ITMQVARNFFLTREKTYNRKLYEILLALKIEQNLSKDQILELYINQIYLGQRAYGFAVAA
RAYYGKRLDELTLPEAAMLAGLPKAPSAFNPVVNPARAAVRQQYVLRRMLETGLIDPSQY
EHALTFATPKQGQRDSAAVRRQQDLFVAGGEHVAEMARQIAVEQFGEQAYELGIRIVTTV
THKDQEAAYAALRKGVLDYDRRHGYRGPEAFVDLAANETSAERFDELLGDTSDHGDLLAA
LVLKASPKEVTVYRRGREFRIEGKGLRFAAPMLADKAPQSRRIRRGAIVRLRDAGKGEWE
LTQLPEVQAALVSLDPHSGAVRALVGGFDFDRTKFNHVTQALRQPGSSFKPFIFSAALER
HFGPGDVLADEPLYYPAGVTGSQDWEPKNYDGKYAGPMTLREALTRSKNMVSIRLLERIT
PEYARDYITRFGFDAARHPPYLTMALGAGTATPWEMAAGYAVFANGGYRIEPYVVKEIYD
NEGRLIARIDPPVAGRSAPRVIDARNAWLMDSMMRDTVQHGTATRARSLKRGDLAGKTGT
TNDYVDAWFCGYHPELVAVAWVGHSQPRNLGRGETGGAAALPIWIDYMGSALEGVPEVQR
PRPDGLVLVDNGLHSGQDYHYAEYTPPEPAPAPSWLEQLFAGDKPRQVIHAPMEAPEEAI
PALPPAAAAHSLPRPAQAPAPVEERAPVPIRR
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtcctgtatccggtcggagcgctgttcgcgctgatcattctcggccttgcc
acgctgacggcgatggcgctgttcgcctggccgaacctgcccgccctcgacaccctgacc
gactatcggccgcgcattcccttgcgcgtctataccgccgacggccacctgctcggcgag
ttcggcgaagagcggcgcgacgtggtgcgcatcgccgaagtgccctcggtgctcaagcat
gcgatcctcgccgccgaagacgagcgcttctacgaacacccgggcatcgacctgatgggg
ctcgtgcgtgccgcgctcgccaacctgtcttccggcggccgcagccagggggcgtcgacg
atcaccatgcaggtcgcgcgcaacttcttcctgacgcgcgaaaagacctacaaccgcaag
ctgtacgagatcctgctcgccctcaagatcgagcagaacctgtccaaggaccagatcctc
gagctctacatcaaccagatctacctcggccagcgcgcctacggcttcgccgtggccgca
cgcgcctattacggcaagcgcctggacgagctgaccctgcccgaagcggcgatgctcgcc
ggcctgccgaaagcgccgtcggccttcaacccggtcgtcaatccggcgcgcgccgcggtg
cgccagcaatacgtgctgcgacgcatgctcgagaccggactgatcgacccgtcccagtac
gagcacgcgctgaccttcgccacgccgaagcaggggcagcgcgacagcgccgcggtacgc
cggcagcaggacctgttcgtcgccggcggcgagcacgttgccgagatggcgcgccagatc
gccgtcgagcagttcggcgagcaggcctacgagctcggcatccgcatcgtcactacggtc
acacacaaggaccaggaagccgcctacgcggcgctgcgcaagggagtgctcgactacgac
cgccgccacggctaccgcggcccggaagccttcgtcgacctggcggcgaacgaaaccagt
gccgaacgcttcgatgaactgctcggcgacacctccgaccacggcgacctgctcgccgcc
ctggtgctgaaagcctcgccgaaggaggtcaccgtctatcgccgcgggcgcgaattccgc
atcgagggcaagggcctgcgcttcgccgcgccgatgctggccgacaaggcgccgcagagc
cggcgtatccgccgcggcgcgatcgtgcgcctgcgcgacgccggcaagggcgaatgggaa
ctcacccagctgcccgaagtgcaggccgcgctggtgtcgctcgatccgcacagcggcgcg
gtgcgcgccctggtcggcggcttcgatttcgaccgcaccaagttcaaccacgtcacccag
gcgctgcgccaaccgggctcgagcttcaagcccttcatcttctcggccgcactcgaacgc
catttcggccccggcgacgtgcttgccgacgagccgctgtactaccccgccggcgtcacc
ggcagccaggactgggagccgaagaactacgacggcaaatatgccggcccgatgacgctg
cgcgaggccctgacgcgctccaagaacatggtctcgatccgcctcctggagcggatcacg
cccgaatacgcgcgcgactacatcacccgcttcggcttcgacgccgcccgccatccgccc
tacctgaccatggccctcggcgccggcaccgcgacgccgtgggagatggccgccggctac
gcggtgttcgccaacggcggctaccgcatcgagccttacgtggtgaaggaaatctacgac
aacgaaggccgcctgatcgcccgcatcgacccgcccgttgccgggcgcagcgcgccccgg
gtgatcgacgcccgcaatgcctggctgatggactcgatgatgcgcgacacggtccagcac
ggcaccgcgacccgggcgcgcagcctcaagcgcggcgatctcgccggcaagaccggcacc
accaacgactacgtcgatgcctggttctgcggctaccaccccgagctcgtcgccgtcgcc
tgggtcggccacagccagccgcgcaacctcggccgcggcgagaccggcggcgccgccgcg
ctgccgatctggatcgactacatgggcagcgccctcgaaggcgtccccgaagtgcagcgc
ccccgccccgacggcctggtcctggtcgacaacggcctgcacagcgggcaggactaccac
tacgccgaatacaccccgcccgagccggcgccggcaccgagctggctcgagcagctgttc
gccggcgacaagcccaggcaggtcatccacgctccgatggaagcgcccgaggaagcgatt
ccggcgcttcccccggcggccgctgcgcactccctgccgcgcccggcacaggctccggcg
ccggtcgaagagcgcgccccggtgccgatccggcgctga

DBGET integrated database retrieval system