KEGG   Thauera aromatica: Tharo_0828Help
Entry
Tharo_0828        CDS       T05381                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
tak  Thauera aromatica
Pathway
tak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tak01100  Metabolic pathways
tak01110  Biosynthesis of secondary metabolites
tak01130  Biosynthesis of antibiotics
tak01230  Biosynthesis of amino acids
Module
tak_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tharo_0828
Enzymes [BR:tak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Tharo_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2
Motif
Other DBs
NCBI-ProteinID: AVR87770
UniProt: A0A2R4BKA9
LinkDB All DBs
Position
848727..849233
Genome map
AA seq 168 aa AA seqDB search
MMGAGKTTVGKELARRRKARFADCDHEIVARTGVSIPTIFEIEGEAGFRRRETQMIDELT
RQPDLVIATGGGVVTTPANRALMRERGIVIYLNVPPQILYERTRHDRNRPLLQVDDPRQR
ITELYQQRDPLYREVADLVVDGGRGNPGTMVRLIETALQTFHKSPCKP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgccggcaagaccacggtcggcaaggaactggcgcggcggcgcaaggcgcgc
ttcgccgactgcgaccacgagatcgtcgcccgcaccggagtgagcatcccgacgatcttc
gagatcgaaggcgaagccggcttccgcaggcgcgagacgcagatgatcgacgagctcacc
cgccagcccgacctcgtcatcgccaccggcggcggcgtggtgacgacgccggccaaccgc
gcactgatgcgcgagcgcggcatcgtcatctacctcaacgtgccgccgcagatcctctac
gaacgcacccgccacgaccgcaaccgcccgctgctgcaggtggacgacccgcgccagcgc
atcaccgagctgtaccagcagcgcgaccccctgtaccgcgaagtggccgacctcgtcgtc
gacggcgggcgcggcaatcccggcaccatggtgcggctgatcgaaaccgccctccagact
ttccacaagagcccatgcaaaccctga

DBGET integrated database retrieval system