KEGG   Thauera aromatica: Tharo_0829Help
Entry
Tharo_0829        CDS       T05381                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
tak  Thauera aromatica
Pathway
tak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tak01100  Metabolic pathways
tak01110  Biosynthesis of secondary metabolites
tak01130  Biosynthesis of antibiotics
tak01230  Biosynthesis of amino acids
Module
tak_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tharo_0829
Enzymes [BR:tak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Tharo_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AVR87771
UniProt: A0A2R4BKD4
LinkDB All DBs
Position
849221..850303
Genome map
AA seq 360 aa AA seqDB search
MQTLNVALGDRAYPIHIGRGLLGRAELVLARLKTPRVAIVTNDTVGPLYLGGLRAALEQA
GVNVSVVSLPDGEAYKTWETLNRIFDMLLTERCERSTTLVALGGGVVGDMGGFAAACYQR
GMPFIQIPTTLLAQVDSSVGGKTAINHPLGKNMIGAFYQPRLVLADIDTLATLPDRELAA
GLAEVIKYGLIRDSDFLAWLEASLERLRARDPEALMYAIERSCRNKAEVVAADETEQGER
ALLNLGHTFGHAIETGLGYGEWLHGEAVAAGTMMAAELSRRLGWLAAGDVDRIEALFVRA
KLPVWGPKLGAARYLALMAHDKKVEAGRLRLVLLHALGRARVHGEAALSEIAAAIEARCR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctgaacgttgccctcggcgatcgcgcctatccgatccacatcggccgcggc
ctgctcggccgcgccgagctcgtcctggcgcggctgaagacgccgcgggtggcgatcgtc
accaacgacaccgtcggcccgctctacctcggcggactgcgcgccgcgctcgagcaggcg
ggcgtgaacgtgagcgtggtgagcctgcccgacggcgaggcgtacaagacctgggaaaca
ctgaaccgcatcttcgacatgctgctcaccgagcgctgcgaacgttcgaccacgctggtc
gcgctcggcggcggggtggtcggcgacatgggcggctttgccgccgcctgctaccagcgc
gggatgcccttcatccagattccgacgaccctgctcgcgcaggtcgactcctcggtcggc
ggcaagaccgcgatcaaccatccgctgggcaagaacatgatcggcgccttctaccagccc
cggctggtgctggccgacatcgacaccctggcgacgctgcccgatcgcgaactggccgcc
ggcctcgccgaagtgatcaagtacggcctgatccgcgattccgacttcctcgcctggctg
gaagcaagcctcgaacgcctgcgcgcgcgcgacccggaggcgctgatgtacgccatcgag
cgctcctgccgcaacaaggccgaagtggtggcggccgacgagaccgagcagggcgaacgc
gccctgctcaacctcggccacaccttcggccacgccatcgagaccggcctcggctacggc
gaatggctgcatggcgaggcggtggcggcgggtacgatgatggccgccgaactgtcgcgc
cgcctcggctggctcgccgcgggcgatgtcgaccggatcgaggcgctgttcgtgcgggcg
aagctgccggtgtggggaccgaagctgggcgcggcgcgctatctcgcgctgatggcacac
gacaagaaggtcgaggccgggcgcctgcgcctcgtgctgctgcacgcgctcggccgtgcg
cgggtgcacggcgaggcggcgctgagcgagatcgccgcggcgatcgaggcacgctgccgc
tga

DBGET integrated database retrieval system