KEGG   Thauera aromatica: Tharo_2056Help
Entry
Tharo_2056        CDS       T05381                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tak  Thauera aromatica
Pathway
tak00061  Fatty acid biosynthesis
tak00780  Biotin metabolism
tak01100  Metabolic pathways
tak01212  Fatty acid metabolism
Module
tak_M00083  Fatty acid biosynthesis, elongation
tak_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Tharo_2056
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Tharo_2056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tak01004]
    Tharo_2056
Enzymes [BR:tak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Tharo_2056
Lipid biosynthesis proteins [BR:tak01004]
 Fatty acid synthase
  Component type
   Tharo_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT AfsA PS-DH
Motif
Other DBs
NCBI-ProteinID: AVR88959
UniProt: A0A2R4BNR7
LinkDB All DBs
Position
complement(2194514..2194948)
Genome map
AA seq 144 aa AA seqDB search
MNINEIIEYLPHRYPFLLIDRVLEIEEGKRIKALKNVTINEPFFPGHFPHHPVMPGVLIV
EAMAQAAAVLSFKSMGVKPDENSVVYFAGIDSVRFKRPVVPGDQLIFDVEITQSKRNIYK
YKGVARVDGDVATEAELMCALKTL
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaacgaaatcatcgagtacctgccgcaccgctaccccttcctgctgatcgac
cgggtactcgagatcgaagaaggcaagcgcatcaaggcgctgaagaacgtgaccatcaac
gagcccttctttccggggcactttccccaccacccggtaatgccgggggtgctgatcgtc
gaggcgatggcccaggccgccgcggtgctgtcgttcaagagtatgggcgtcaagcccgac
gaaaactccgtggtgtacttcgccggcatcgacagcgtgcgcttcaagcgcccggtggtg
cccggcgaccagctgatcttcgacgtcgagatcacccagagcaagcgcaacatctacaag
tacaagggcgtggcccgcgtcgacggtgacgtggcgaccgaggccgagctgatgtgcgcg
ctgaagaccctatga

DBGET integrated database retrieval system