KEGG   Thauera aromatica: Tharo_2537Help
Entry
Tharo_2537        CDS       T05381                                 

Definition
(GenBank) putative aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tak  Thauera aromatica
Pathway
tak00030  Pentose phosphate pathway
tak01100  Metabolic pathways
tak01120  Microbial metabolism in diverse environments
tak01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tharo_2537
Enzymes [BR:tak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tharo_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Kunitz_legume
Motif
Other DBs
NCBI-ProteinID: AVR89433
UniProt: A0A2R4BQG2
LinkDB All DBs
Position
complement(2721112..2722959)
Genome map
AA seq 615 aa AA seqDB search
MGWNRKILRVNLAQGTCTEEPLNMQWAQDYLGSRGLATKYLVSEIDPQVDPLSPANKMIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMVIFEGRAPKPVW
LYIENDHAELRDAAGLWGKSCWETEEQIRHELQDPLVRVSSIGVAGENQVLFACIVNDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVAGIRDFGAFVHATSAAKKVLADNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEDASKISAEAMHEKRASDGKPHLVTNAACFGCTI
ACGRISAIDPSHFTVKNSPKYWGASGGLEYEAAWALGAANGVGDLEALQYANLVCNEQGM
DPISFGATVGAAMELYEMGVLDDARIGLPAPFGSAAALAKLVEMTALGEGFGKELGLGSR
RLCEKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVMGIPVK
TDPHVTEGKAELVKAFQDATAVFDSAGICVFTSFAWTLADVQPQIAAACEGDWSMDKLNE
VGERIWNMERQFNNAAGFTASDDTLPPRLTQEPARTGPAKGMVNALAKMLPEYYKVRGWT
PGGVPTAQTLERLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaagatcctgcgggtcaacctggcgcagggcacgtgcacggaagag
ccgctgaacatgcagtgggcgcaggactacctcggttcgcgcgggctggccaccaagtac
ctggtgtccgagatcgacccgcaggtcgatccgctgtcgcccgccaacaagatgatcatg
gccaccggcccgctcaccggcaccatggcctccaccggcgggcgctacaccgtcgtcacc
aaggggccgctgaccggggcgatcgcgtgctcgaactcgggcggcttcttcggcgccgag
atgaagttcgccggctgggacatggtgatcttcgagggccgcgcgccgaagccggtgtgg
ctctacatcgagaacgaccacgccgagctgcgcgacgccgccgggctgtggggcaagagc
tgctgggagaccgaggagcagatcaggcacgaactgcaggacccgctcgtgcgcgtgtcc
tcgatcggcgtcgccggcgagaaccaggtgctgttcgcctgcatcgtcaatgacctgcac
cgtgccgccgggcgctccggcgtgggcgcggtgatgggctcgaagaacctgaaggcggtg
gcgatccgcggcaccaagggggtggcgggcatccgcgacttcggtgccttcgtgcacgcc
accagcgcggcgaagaaggtgctcgccgacaatgcggtgaccggccagggcctgcccaag
tacggcacccaggtgctgatgaacgtgatcaacgagatcggcgcgctgcccacgcgcaac
caccgcgacgtgcagttcgaggacgcctccaagatttccgccgaggcgatgcacgagaag
cgcgcgtccgacggcaagccccacctcgtcaccaacgctgcctgcttcgggtgcacgatc
gcctgcggccgcatctcggcgatcgacccgagccacttcacggtcaagaacagcccgaag
tactggggcgcttccggcggcctcgagtacgaggcggcgtgggcgctcggcgcggccaac
ggcgtcggcgacctcgaggcgctgcagtacgccaacctcgtgtgcaacgagcagggcatg
gacccgatctcgttcggcgccaccgtcggcgcggcgatggagctctacgaaatgggcgtg
ctcgacgacgcccggatcggcctgccggcgcccttcggctcggccgcggcgctggcgaag
ctggtggagatgaccgcgctcggcgagggcttcggcaaggagctcgggctgggcagcagg
cgcctgtgcgagaagtatggccaccccgagctgtcgatgagcgtgaaggggcaggaattc
cccgcctacgattcgcgcggcatccagggcatgggcctcgcctacgccacctcgaaccgc
ggcgcctgccacctgcgcggctacaccgtggcctccgaagtgatgggcattccggtcaag
accgatccccacgtcaccgaaggcaaggccgagctggtgaaggccttccaggatgcgacc
gcggtgttcgactcggccggcatctgcgtgttcaccagcttcgcgtggaccctggccgac
gtccagccgcagatcgccgcggcgtgcgagggcgactggagcatggacaagctcaacgaa
gtcggcgagcgcatctggaacatggagcgccagttcaacaacgctgccggcttcaccgcc
agcgacgacaccctgccgccgcgcctgacccaggagccagccaggaccgggccggcgaag
ggcatggtgaacgcgctcgcgaagatgctgccggagtactacaaggtgcgcgggtggacg
cccggcggcgtgcccaccgcgcagaccctggagcggctcggcctgtag

DBGET integrated database retrieval system