KEGG   Terriglobus albidus: FTW19_21545Help
Entry
FTW19_21545       CDS       T06135                                 

Definition
(GenBank) histidine-type phosphatase
  KO
K01093  4-phytase / acid phosphatase [EC:3.1.3.26 3.1.3.2]
Organism
talb  Terriglobus albidus
Pathway
talb00562  Inositol phosphate metabolism
talb00740  Riboflavin metabolism
talb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:talb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    FTW19_21545
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FTW19_21545
Enzymes [BR:talb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     FTW19_21545
    3.1.3.26  4-phytase
     FTW19_21545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: QEE30337
LinkDB All DBs
Position
5380209..5381477
Genome map
AA seq 422 aa AA seqDB search
MSSSKFLLLTIVSGLLASGQAADAVTRKPGHPMDEQLVMTVVLSRHGVRSPTWAPERLNR
YSATPWPTWQAQPGYLTDRGFQLLERFGSYNRAALAQHGLLSSEGCSDASSVYIWADTDQ
RTLESGKALAKGLFPACPPEVHSQPGGGNDPIFHARDTAPTARQTQQIQQDLQARIPAAM
AKADPLIDEMQQILQGCKPGVACTPARKPEHLLRESATAVSPGRGDRAVDLLGPLPLASS
FSEDLLLEYADDMPEQQLGWGNAGSSEVKHILDLHTIYFDLIHRTPSMAQLEATSMLRHI
AMTLSQRATGTPSPDAVGPGDAKVVYFVGHDTNLAGVASLLGVHWKLDGRDDDTPPGTQL
AFQLWRVGHRYEIRIQVAMQTLEQMRHLEQLTLTSPPARQELTVPTCAPQQCNVEQFVSL
HP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctcatcgaagttccttctattgaccatcgtcagtggtctgctcgcttccgggcag
gccgctgacgccgttacgcgcaagccaggccatcccatggacgaacaactcgtcatgaca
gtcgtcctgtcgcggcatggtgtgcgttctcctacgtgggctccggaacgtctaaaccgt
tactctgctactccctggcccacgtggcaggcacaacccggctatctgacggatcgcggc
ttccagctcctggaacgcttcggcagctataaccgtgccgcattggcacaacacggcctg
ttgtcgtctgaaggatgcagcgatgcgtcgtctgtctatatctgggccgataccgatcag
cgcacccttgagagcggcaaggctctcgccaagggtctgtttcctgcatgtccgcctgag
gtccattcacagcccggcggaggcaacgaccctatctttcacgctcgtgacacggcacca
accgcgcggcagacccagcagatacaacaggaccttcaagccagaattcccgccgcgatg
gcaaaggccgatccgctgatcgatgagatgcaacagatcctgcagggctgtaagcccggc
gtcgcctgcacaccggctcgcaagccggaacacctgctgcgcgagagtgcgacggcagtc
tctccgggtcgcggcgaccgggcggtcgatcttctcggcccgctgccgctggcttcatcc
ttctccgaagaccttttgctggagtacgccgacgacatgccggagcagcagctcggctgg
ggcaatgccggctcctctgaggtgaaacacatcctcgacctgcacaccatctacttcgac
ctgatccaccgcacgccgtcgatggcgcagcttgaagccaccagcatgctgcgtcacatc
gcgatgacgctctcgcagcgcgccaccggtacaccatcgccggatgccgtcggccctggc
gatgcgaaggttgtctacttcgtcgggcatgataccaatctggccggcgtcgcctcgctg
ctgggagtccactggaagctggatggccgcgacgatgacacgccgccgggaactcagctc
gccttccagctatggcgagtcggccaccgctatgagatccgcattcaggtcgccatgcag
acgctcgagcagatgcgtcatctggaacaacttacgctcacctcgccgcctgctcgacag
gagctgacagtgcccacctgcgcgccgcagcaatgcaatgtggagcagtttgtctcgctc
cacccgtag

DBGET integrated database retrieval system