KEGG   Thermovibrio ammonificans: Theam_0255Help
Entry
Theam_0255        CDS       T01391                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
tam  Thermovibrio ammonificans
Brite
Translation factors [BR:tam03012]
 Eukaryotic Type
  Elongation factors
   Theam_0255
 Prokaryotic Type
   Theam_0255
Mitochondrial biogenesis [BR:tam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Theam_0255
Exosome [BR:tam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Theam_0255
  Exosomal proteins of breast cancer cells
   Theam_0255
  Exosomal proteins of colorectal cancer cells
   Theam_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ADU96228
UniProt: E8T418
LinkDB All DBs
Position
241771..242967
Genome map
AA seq 398 aa AA seqDB search
MAKQKFERTKPHKNVGTIGHVDHGKTTLTAAITHCLALQGKAQEVSYDQIDKAPEERERG
ITIATAHVEYESDKYHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHV
LLARQVNVPAIVVFLNKVDMVDDEELLELVELEVRELLSEYGYPGDEVPVIRGSALKALE
CTDPNCEWCQPIYELVKALDEYVPEPVREIDKPFLMPIEDVFSISGRGTVVTGRVERGTL
KVGDEVEIVGLRDEPIKTVATGIEMFRKVLDEALPGDNIGVLLRGVGKDEVERGMVVAKP
GSIKPHRKFKAEVYILSKEEGGRHTPFFNGYQPQFYFRTTDVTGKVKLPEGVEMVMPGDN
VTFEVELLKPVAIEEGLRFAIREGGRTVGAGVVTEILD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagaagtttgaaaggacgaagccccacaagaacgtgggaacaatcggccac
gttgaccacggcaagactaccctgacagcggcaatcacccactgccttgcgctgcaagga
aaagcccaggaagtatcctacgaccaaatcgacaaagcccctgaagagagagaaagggga
atcacaattgcgacagcccacgtagaatacgaatccgacaaataccactacgcccacgta
gactgcccgggccacgccgactacatcaaaaacatgataaccggtgcggcccagatggac
ggagcgatactcgtagtatctgcggcagacggcccgatgccccaaacgagggaacacgta
cttcttgcgagacaagttaacgtacctgcgatagtagtattcctcaacaaagtagacatg
gtagacgacgaagaacttcttgaacttgttgaacttgaagttagagaactcctctccgaa
tacggctaccctggagacgaagtacccgtaatcaggggatctgcccttaaagcccttgaa
tgcaccgaccccaactgcgaatggtgccagccgatatacgaacttgtaaaagcccttgac
gaatatgtacctgagcctgtaagagaaatcgacaaacccttcctgatgccgatagaagac
gtattctccatctctggacgtggaacagtagtaacaggaagagtagagagggggaccctg
aaagtaggagacgaagtagaaatagttggattaagggacgagcccataaagacagtggcg
acaggaatagaaatgttcaggaaagtacttgacgaagccttacctggagacaacatagga
gtgctgcttaggggagtagggaaagacgaagtagagcgcggaatggtagtagccaagcct
ggtagcatcaagccccacaggaagttcaaggcggaagtttacatactgtctaaagaagaa
gggggaaggcacaccccgttcttcaacggataccagccgcagttctacttcaggacgacg
gatgtaacagggaaagttaagctgcctgaaggcgtagagatggtgatgcctggagacaac
gttacctttgaagtagagcttttaaagcccgtagctattgaggaagggctgaggtttgcg
attcgtgaaggtggaaggacagtaggtgcaggtgttgttaccgagattcttgactaa

DBGET integrated database retrieval system