KEGG   Thermovibrio ammonificans: Theam_0765Help
Entry
Theam_0765        CDS       T01391                                 

Definition
(GenBank) SMC domain protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
tam  Thermovibrio ammonificans
Brite
KEGG Orthology (KO) [BR:tam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tam03400]
    Theam_0765
DNA repair and recombination proteins [BR:tam03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Theam_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_23 AAA_21 Rad50_zn_hook SbcCD_C
Motif
Other DBs
NCBI-ProteinID: ADU96732
UniProt: E8T6E8
LinkDB All DBs
Position
complement(711252..713936)
Genome map
AA seq 894 aa AA seqDB search
MIRLRGLSLKNFLSHRSTEIPFTDQAFVILGENASGKTSILRGVFFGVFGEDLKRAKAEE
LINRASNSAEVKVEFLYKGKLYTLERRIHVRRSSEAELYEDGRLVARGVKQVKAYLLENL
GLDGNLFKNTVFVPQGEILDLFKGTPKERRKVLNRLLGLEEIGELHRRIKEELQKLKNTL
NLVVERVKHYQESRQRLRELQLRLQEKERELERVERLRELETEKVEGIKEELRALQAEKE
KLLRVETSLKNASSNVKRLAESVERLKARETELLKLEAELPRLQEEVKALEPLKEIRELL
LRAGELQNRERTLQRDVEQAEEALEKKRLIPDFEEKLKIQQEKNLLSREKIKKAQQRLKE
KREALAAKEAELKKLQEAEERLRKLRETLPQVTEETVLQTQNRLSEVERAIREKELQLRT
LNEQVELLKKRLQTLETAESACPICGSKLTPEKKERLLEETRQELNSSLTLIEQLERELR
ELRQEEPALKRRLKELQRKLEEKRLLAAQIKELEVETRELSKLKEETNGLKEELLKEEKQ
FKKLEEENLKEVQELSALKERLQALKKEASRFSEEELQKLKEELEATKREKEELLKRAGE
IRDRVAPELKKREQVEARIRELEKSARELEKIKGALSEKERIREELNRLEQELKSFKEKE
RELSQELKALNPVRDKLRKLQKEEEDGERRIRSLIEEASKLKGEIEELRRQIGAIREELK
RLEVEKQCASKLKDAVSLLEIQERSFHPERGFLQRVRRELLPQVAQQCKELFAAFDFDFS
EVEIDEDFTVSFGVPGRGTLTLEQLSGGQQIAFALALRFAMAKQFNQKMELLVLDEPTVH
LDQPRRTALTELLMKLKNSIPQMVVITHDPELEVVADQTIKVRMVNGYSEVTVE
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
ttgataaggctgaggggactgagcttaaagaacttcctctcccataggagcacggagata
ccctttaccgaccaggcctttgttattctcggcgagaacgcctccgggaagacctctata
ctccggggcgttttcttcggggtgttcggggaagacctaaaaagggcaaaggccgaagag
ctcataaacagggcctcaaactcggcagaggtaaaggttgagttcctctacaaggggaag
ctctacaccttagagcggagaatccacgtccgcaggagctccgaggcggagctatacgaa
gacggcagactcgtagcaaggggcgttaaacaggttaaagcctacctccttgagaacctg
ggcctcgacggtaacctgtttaagaacacggtgttcgtgcctcagggggagattctcgac
ctcttcaaggggacccccaaggagaggcggaaggttctgaacaggctactgggcctggag
gagataggggagcttcacaggcggataaaggaggagcttcaaaaactcaaaaacacccta
aacttggttgttgaaagggttaagcactaccaggagagccggcagaggctaagggagctt
cagctccgccttcaggagaaggagagggagcttgagcgggttgaaaggctgagagagctc
gaaaccgaaaaagtagagggaatcaaagaggagctccgcgctctgcaggcggaaaaggag
aagctcctgagggtcgaaacatccctaaagaacgcttccagcaacgttaaaaggcttgcc
gagagcgttgaacggctgaaggcaagggaaacggagcttttaaagctggaggcagagctt
ccccgactccaagaggaggttaaggcccttgaaccgctgaaggagataagggagctcctt
ttaagagccggagagcttcaaaaccgcgagcgcaccctccagagggatgttgagcaggcg
gaagaggcgcttgagaagaagcggctcatacccgattttgaagagaaactcaaaatccaa
caggagaaaaacctcctctccagagagaaaattaaaaaggcccagcagaggcttaaagaa
aagagggaagctcttgcggccaaagaggccgagctgaaaaagctccaagaggcggaggag
aggctccgaaaactccgggagaccctgcctcaagtaaccgaagaaacggttctacagacc
caaaacaggctctccgaggtagagagggcaataagggagaaagagcttcaactccgcacc
ctgaatgagcaggtggagctattgaaaaagaggctccaaacccttgaaacggccgagtct
gcctgccccatatgcggctccaaactgacgccggagaaaaaagagaggctcttagaggag
acccggcaagagctaaacagctcccttaccctgatagagcagctggagagggagctcaga
gagctccggcaggaagagcccgccctaaaaaggagactgaaagagctccagaggaaactg
gaggaaaaaaggctccttgccgcccaaataaaagagctggaagtagaaacccgggaactc
tcaaagctaaaagaggagacaaacgggcttaaagaggagctcttaaaggaggaaaaacag
tttaaaaaactcgaggaggaaaacctcaaagaggttcaagagctgagcgccctaaaagag
agactccaggccctaaagaaggaggcttcccgcttctccgaagaggagctccaaaaactc
aaggaagagctcgaggccacaaagagggagaaggaggagctcttaaaaagggcaggggaa
atcagggacagagtggcccccgagctcaagaagagagagcaggtagaggccagaatcaga
gagctcgaaaagagcgcaagggagctggagaagataaagggagcgctatcagaaaaggag
cggatacgggaagagctaaaccgccttgaacaagagttaaagagctttaaggaaaaagag
cgagagctctcccaagagcttaaagctctgaacccggtgagggataagctccggaagctc
cagaaggaggaagaggacggagagaggagaatcagaagcctcatagaggaggcctcaaag
ctcaaaggggagatagaggagctccgcaggcagataggggcaataagggaagagctcaag
aggctggaagttgaaaaacagtgtgcatcgaagctgaaggacgccgtctccctccttgag
atacaggagaggagcttccaccccgaaaggggcttcctccagagggtaaggagggagctt
ctgccccaagttgcccagcagtgtaaagagctctttgcggccttcgacttcgacttcagc
gaagtggagatagacgaagactttacagtctccttcggagtacccggcaggggaacacta
accttagagcagctgtcggggggccagcagatagccttcgccctggccctaaggtttgca
atggctaagcagtttaaccaaaagatggagctcttagtcctcgacgagcccacagtccac
ctggaccagcccaggagaacggcccttacagagctcctgatgaagctgaaaaactccata
ccccaaatggttgtaataacccacgaccccgaacttgaagttgttgcagaccaaacgatt
aaagtgagaatggtaaacggctactcggaggtgaccgttgagtag

DBGET integrated database retrieval system