KEGG   Theileria annulata: TA03455Help
Entry
TA03455           CDS       T00253                                 

Definition
(RefSeq) succinate dehydrogenase (flavoprotein) subunit, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tan  Theileria annulata
Pathway
tan00020  Citrate cycle (TCA cycle)
tan00190  Oxidative phosphorylation
tan01100  Metabolic pathways
tan01110  Biosynthesis of secondary metabolites
tan01130  Biosynthesis of antibiotics
tan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TA03455
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TA03455
Enzymes [BR:tan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TA03455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 3864625
NCBI-ProteinID: XP_954921
GeneDB: TA03455
UniProt: Q4UCK6
LinkDB All DBs
Position
3
AA seq 592 aa AA seqDB search
MTEDDWRWHFYDTVKGSDWLGDQDSIYHMCKSAPEAVIELENFGVPFSRTEDGKIYQRAF
GGQSLNFGKGGQAYRCAAVADRTGHSLLHTMYSTCLKYNCSFFIEYFLLELIKHPNENRV
IGAIFLRMSNMELHVFRSNHVVIATGGFGRCYFSCTSAHMCTGDGNAAVSRLGLPNQDME
FVQFHPTGIYPAGCLITEGCRGEGGILRNSEGEAFMARYAPVAKDLASRDVVSRSMTIEI
NEGRGCGPNKDHLYLDLTHLSEDVFREKLPGITETSKIFAGVDASKQYIPVLPTVHYNMG
GVPTNYKTEVLTSNLLQSMAENSTNSNTTADSKKSSGKSKKKSTPNQKLEDSVVYGLYSA
GESACASVHGANRLGANSLLDIIVFGKMSGTTINEKIKSDSSNKLNLPNQTHYDDVVEKT
SNKLSNLLNTTNNNNNLGGLGVKVSDLRLEMQKNMQKYVSVFRNGDSLKEGREKIKELAN
QFQYVKISDPSKVFNTDLLEALELENLLQLSLQIVTGAEARKESRGAHSREDYPKRDDVN
FRKHTLTYLHNPSQSNSTQLFSYKFHYVFIILLKITHKLMLQCMTEVMEDMM
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggatgactggcgctggcacttttatgacacagtcaagggctcagactggctt
ggtgaccaggatagcatttatcacatgtgtaaaagtgccccggaggccgtgattgagctt
gagaactttggcgtcccgttctccaggactgaagacgggaaaatttatcaaagagccttt
ggaggccagagccttaattttggtaaaggggggcaagcgtacagatgtgcagctgtggct
gacagaaccggccactcactgcttcacacaatgtactcgacctgccttaaatataactgt
tcattcttcattgaatatttcctactggaactcatcaaacacccgaacgagaatcgagtt
attggagcgatatttttgagaatgagtaatatggagttacatgtgttcaggagtaaccat
gtggtgatagcaacgggtgggtttggccgatgttattttagctgcacatctgcccacatg
tgtactggtgatgggaacgcagctgtgagtagactgggacttccaaaccaggacatggaa
tttgtacaatttcatcctacaggaatatatccagcaggctgtttaattacagaaggttgc
agaggcgagggtgggatcctacgtaattccgaaggtgaagcttttatggccagatacgca
ccggtggccaaggatttggcctcaagagatgttgtcagcaggtcaatgacaattgaaatt
aatgagggccgaggctgcggccctaataaggatcacctataccttgatttaacacatctg
tctgaagatgtatttagagaaaaattacctggaattaccgaaaccagcaagattttcgca
ggagttgatgcctccaagcaatatatcccagtcttaccaactgttcattataatatgggc
ggtgtacccaccaactataaaactgaagttctaacaagcaacttactacagagtatggct
gaaaattcaactaattccaacaccactgctgacagtaagaagtcgagtggaaagagtaag
aagaagagcactccaaatcagaaattggaagattcagtggtatacggtttatatagcgct
ggcgaaagtgcatgcgcaagtgtccacggagctaatagattaggcgcaaattcactatta
gatattatcgtatttgggaaaatgtccggaaccacaataaatgaaaaaataaaatccgac
tccagcaacaaacttaacttaccaaaccaaacacattatgatgatgttgttgaaaaaact
tccaacaaattatcaaatcttctgaataccaccaataataacaataatctaggtggtctc
ggcgtaaaagtgagcgatttgagattggaaatgcagaagaatatgcaaaagtatgttagt
gtatttaggaacggtgattcattaaaggaagggagagaaaagatcaaagaattagcaaac
caatttcaatatgttaaaataagtgatccgagtaaagtatttaatacggatttactcgaa
gctcttgaacttgaaaatttattacaactcagtttgcaaattgtaacaggcgcagaagct
agaaaggagtctagaggtgctcattcacgtgaagattatcctaagcgtgatgatgtcaat
tttagaaaacacactctaacatatcttcataatccctcacaaagtaattccactcagtta
tttagttataaattccattatgtatttattatattacttaaaattacacataaattgatg
ctacagtgtatgacggaagttatggaggatatgatgtag

DBGET integrated database retrieval system