KEGG   Theileria annulata: TA17435Help
Entry
TA17435           CDS       T00253                                 

Definition
(RefSeq) hypothetical protein, conserved
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: Spindle_Spc25 Atg14 CENP-F_N Cluap1 TMPIT
Motif
Other DBs
NCBI-GeneID: 3865320
NCBI-ProteinID: XP_955524
GeneDB: TA17435
UniProt: Q4UAV3
LinkDB All DBs
Position
3
AA seq 259 aa AA seqDB search
MAIHNSPVDNDNNYVISDIFGSNSLKSDGMISLFPSDSKFKFDHLYLNQIDQNKIKETVQ
KQKNDFLNKLSSVSKINRSLKSNIDELSQSTSTILREIQINDISFNSISDDVSNVYKQIE
DSKNLLNDLRTEKSQLKSLLSSKTEEYESYFKNTNLKDIWSSKVTYLELLLGIKISSLSY
TLTFLLILDGSMKISFSRLIGSNPYTICMIILKLEDERFIGISSDPPIKDFSKLVSELNN
GLDFGSFLCLVRKSFKMVL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcataattctccagttgataatgacaacaattatgtcatttccgatatattt
ggctccaactcattgaagagcgatggtatgatctcattatttccttctgactctaagttt
aagtttgatcatttatatttaaatcaaatcgaccaaaacaagattaaagaaactgttcaa
aagcaaaaaaatgattttttaaacaaattatcttccgtttcaaaaattaaccgttcatta
aagtcaaatattgacgaactatcgcagtcaacatcgacaatattgagggaaattcaaata
aatgacatttcctttaactcaattagtgatgatgtgtcaaatgtttataagcaaattgag
gattccaaaaaccttttgaacgacttgagaactgaaaagtcacaactaaaatcattatta
tcatctaaaactgaagaatatgaatcatacttcaagaatacaaatttaaaggatatttgg
tcatctaaggtcacttatttggagctcctgttggggataaaaatttcaagcttaagttac
acattgacttttttattaattttagatggttcaatgaagatttccttttccagacttata
ggttcgaatccatatacaatttgtatgataattctcaaactagaggatgagagattcatt
ggaatctcgtccgacccaccaattaaggatttcagtaaactagtcagtgaacttaacaat
ggtcttgactttggttcatttctatgcctagttaggaaatcattcaaaatggttttatga

DBGET integrated database retrieval system