KEGG   Theileria annulata: TA17925Help
Entry
TA17925           CDS       T00253                                 

Definition
(RefSeq) fad-dependent glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tan  Theileria annulata
Pathway
tan00564  Glycerophospholipid metabolism
tan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TA17925
Enzymes [BR:tan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TA17925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored GIDA NAD_binding_8 Thi4 Pyr_redox_3 DUF1962 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 3864911
NCBI-ProteinID: XP_955415
GeneDB: TA17925
UniProt: Q4UB62
LinkDB All DBs
Position
3
AA seq 615 aa AA seqDB search
MGFKTFTKVFGVGSAAVAGSYIFVKREHEKCSIPKNTKYSVPEKLKTRNEMLNKLKTEKF
DVLVIGGGCTGTSVALDLATRGVNCALVEANDFASGTSSKSTKLLHGGIRYLENAIYKLD
FRELRFVWKALEERAHLIGSLPYANYPIPIVMPIYQYWQLPYFWVNIKVYEMLARFFCCN
ETKIPSSFYSDKSNALFNFPGLRTNGLLGAVVYYDGQHNDSRTNLMMALTSTVNNYVPGQ
KGSTVCNYVKVKKILRDPDTNTVNGAVVEDVLSGEEFTVNTKVVVNCTGPFAGETKRLND
PESDLSILHSRGTHLTLPRKYCPTPYGLIIPKTTDGRVLFVLPWLNETIIGTTDNKDDLA
CNPKPTKEDVEFITKDASIYMNCPNEQLKSEIKSLWSGLRPLIKGVDEVNQTGKLSRGHI
IEVDKTGMVNVYGGKWTICRLMAQDCVDELLKFYKDLKQSYKCRTRNLVLLGTHDKDGNS
NFDEIRPRFNLLSYKLMKDYGVDHDTANHLVESYGYKSEDVCKLSKENNLLSKIHENYPY
LLGEVVYGIRNELACTPVDVLARRTRLAFLDAKAALQSLDKVVSVMEKELNWSPKTKKAL
YLEAQDYFQQMSHIP
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggattcaagacatttacaaaagttttcggagttggttctgccgcagtagccggttct
tacatctttgtaaaaagggaacatgaaaagtgctcaatacctaaaaacaccaaatatagt
gttccagaaaaattaaaaacaagaaatgaaatgctcaataagttaaaaactgaaaagttt
gatgttttagttatcggaggaggatgtacaggaacttcagttgccctggatttggcgacg
cgtggcgtaaactgtgcgctggtcgaagccaacgactttgcttcaggtacatcatccaag
agcacaaagctacttcacggaggaatcagatacctagaaaacgcaatttataagttggat
ttcagagaactccgttttgtttggaaagcactggaagaaagagcacacctgataggctca
cttccctacgctaattatcccattccaattgttatgccaatttatcagtactggcaactg
ccatatttctgggttaacatcaaggtgtacgaaatgctggcgagattcttctgttgcaac
gaaacaaagattccaagctcattttatagtgacaagtccaacgccctgtttaatttccca
ggcctgagaaccaacgggctcctaggagcagttgtgtactacgacggacaacataacgac
tccagaaccaacttgatgatggccctcacgagcacagtgaacaactatgttccaggccag
aagggttcaacagtttgcaactacgttaaggtcaagaagattctcagagacccagataca
aataccgtaaatggagccgtagttgaagacgttctatcaggagaagagttcacagtaaac
accaaggttgttgtcaactgcaccggaccatttgcaggagagaccaagaggttgaatgat
ccagaatccgatttgtcaattttacatagcagaggaacgcacttaacacttccaaggaag
tattgccctacaccttacggtctgataattccaaaaaccacagatgggagagtccttttc
gtacttccatggcttaatgaaaccattattggaaccacagataataaagacgacttggcc
tgtaacccgaaaccaacaaaagaagacgttgagttcataacaaaggatgcatcaatttac
atgaattgcccaaatgaacaattaaaatctgaaatcaagtcactctggtcaggcttgaga
cctctgatcaagggagtggatgaggtaaatcaaactggaaagttgtcaagaggccatatc
attgaagtagataaaacaggcatggttaatgtgtacggaggaaagtggactatctgccgc
ctaatggcacaggattgcgttgacgagctgctcaagttctacaaggacctgaaacaaagc
tataaatgccgtacaagaaatttagtactattaggtacacatgacaaggacgggaattct
aactttgatgaaatcagaccaagatttaatctcctctcctacaaacttatgaaagactac
ggagtcgaccatgacaccgcaaaccacttggtggaaagttacggatacaagtcagaggac
gtatgcaagctgtcaaaggagaataatttgttaagcaagatccatgaaaactacccgtac
ctactcggagaggtggtttatggaatcagaaatgaactcgcatgtactccagtagacgta
ctggcaaggaggacaaggctggcatttctagacgcaaaagcagctcttcagagtctggac
aaggtggttagcgtgatggagaaggagctgaattggagtcctaagaccaaaaaggcactg
tatcttgaagctcaagattacttccagcaaatgtcacacatcccataa

DBGET integrated database retrieval system