KEGG   Thiomicrospira aerophila: THIAE_00490Help
Entry
THIAE_00490       CDS       T03589                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tao01100  Metabolic pathways
tao01110  Biosynthesis of secondary metabolites
tao01130  Biosynthesis of antibiotics
tao01230  Biosynthesis of amino acids
Module
tao_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THIAE_00490 (aroK)
Enzymes [BR:tao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     THIAE_00490 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin Cytidylate_kin2 ATP_bind_2 dNK AAA_22 AAA_17 AAA TsaE CoaE Rad17 AAA_16 ABC_tran AAA_5 AAA_28 FtsK_gamma Ploopntkinase3 APS_kinase AAA_24 Zeta_toxin RuvB_N RNA_helicase AAA_PrkA AAA_29
Motif
Other DBs
NCBI-ProteinID: AHF00425
UniProt: W0DP86
LinkDB All DBs
Position
114180..114707
Genome map
AA seq 175 aa AA seqDB search
MNKQSIFLVGPMGAGKSTVGRILAEKLGYEFIDSDHEIEARTGVTIPVIFDIEGEGGFRA
RESAVIDDITQLPGLVLATGGGAVLSADNRRHLAARGFVVYLRSTVPALVQRTKNDRNRP
LLQTDNPEAVIAHLLTERGPLYEEVADLIVDTQQASVFRVVRHIQDQLVREGVVA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaagtatttttttagtcgggccgatgggcgccggaaaatcgaccgttggg
cggattttggccgaaaaattgggctatgagtttattgatagtgaccatgaaatcgaggca
cgcaccggtgtcaccattccggtcattttcgatattgaaggcgaaggcggatttcgggcg
cgtgaatccgcagtgattgatgatattacccaattaccaggcctggtgctcgcaaccggt
ggcggtgcggtattgtctgccgataatcgccgacacctggccgcacgcgggtttgtggtg
tacttgcgttctaccgtaccagctttagtgcagcgtactaaaaatgatcgcaatcgtccg
ctattgcaaactgataatcctgaagcggtgattgcgcacttactaacagagcgaggcccg
ctttatgaagaagtcgcagacctgattgtagatacgcaacaggcatccgtgtttcgtgtg
gtgcgccatattcaggatcagttggtgcgcgaaggcgttgtagcctaa

DBGET integrated database retrieval system