KEGG   Thiomicrospira aerophila: THIAE_01605Help
Entry
THIAE_01605       CDS       T03589                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
tao  Thiomicrospira aerophila
Brite
KEGG Orthology (KO) [BR:tao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    THIAE_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHF00631
UniProt: W0DUS4
LinkDB All DBs
Position
322755..323522
Genome map
AA seq 255 aa AA seqDB search
MLEQVLLFFISLVANLLSALAGGGAGLLQLPALLFLGLPFGVALATHKVASVFLGLGATA
RHWRSSTLDWRFAAFILACGLPGVVLGASFILQVDERWATLALGLLTLSLGIYSWLKPEL
GQISQPQNRQVAGLLIGGIVILMIGVLNGSLTSGTGLFVTLWLVRWFGLDYKTAVAYTLV
LVGIFWNGMGALTLGILGDIMWSWLPALILGSLIGGYLGAHLSIVKGNKLVKRAFEVITI
LVGMALIYQAWSLGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaacaagttttgttattttttatttcgctggtagcgaatttattatccgcgcta
gccggtggcggcgcaggcttgctacagctgccggctttgttgtttctagggttgccgttt
ggggtggccttagcaacgcataaggtcgccagtgtgtttttaggcttgggggcaaccgcg
cgacattggcgcagttcaacgcttgattggcgatttgcggcatttattctagcttgtggg
ttacccggtgtcgtgcttggcgctagttttattttacaggtagacgaacgttgggcgacc
ttggctctggggttgctaactctcagtttaggcatttattcctggctaaagcctgaacta
ggacaaatttcacagccgcaaaatcgccaagtagcaggcctgctaattggtggtattgtg
attttaatgattggcgtgctaaatgggtcactcacctccggtacgggattatttgtcaca
ctgtggttagtgcgttggtttggtcttgattataaaacggcggttgcctataccctggtg
ttagttggcattttttggaacggcatgggcgctttaaccttgggtattttaggtgacatt
atgtggagctggctgcccgcgttaattttagggtcgctaattggcggttatttaggcgcg
catttgtcgatagtcaaaggcaataagctggttaaacgtgcatttgaagtgattaccatt
ttagtgggcatggcgctcatctaccaggcctggtcacttgggagttaa

DBGET integrated database retrieval system