KEGG   Thiomicrospira aerophila: THIAE_02495Help
Entry
THIAE_02495       CDS       T03589                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00620  Pyruvate metabolism
tao00680  Methane metabolism
tao00710  Carbon fixation in photosynthetic organisms
tao01100  Metabolic pathways
tao01120  Microbial metabolism in diverse environments
tao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THIAE_02495
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    THIAE_02495
   00680 Methane metabolism
    THIAE_02495
Enzymes [BR:tao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     THIAE_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF1400
Motif
Other DBs
NCBI-ProteinID: AHF00796
UniProt: W0DVA5
LinkDB All DBs
Position
complement(514021..516825)
Genome map
AA seq 934 aa AA seqDB search
MNVSAQTESHDKQLRARVKLLGQLLGEVIESQVGRATLDAVEKLRRGYIQLRKQDDPELR
QSLINFIEQQTPENLILIIRAFNIYFSLANLAEEEHQYHDRQSQLKSDGPLWMGSMLQTI
GEFKEAGLSSDDVSKLLSRIKYIPVFTAHPTESKRRAVMENLRRIFVTLDGLNEAETHNN
SYTKQDVIDKLRYQIQVLWKTDEVRQSKPTVSDEIRNGIYYFRQSLFQSVPQVYRYLERA
LSRHYPDIAHQVPPFLSFGSWIGGDRDGNPFVTHQTTREAIYLQSRSVLYEYEKRLLELS
AMLTHSRHICDIHQDVINRATIVDADLLEKVFHKRAERFKDEPYRRFLYLMRGRIRENLA
YIEARLNNEQPQSSSRFAYSSEDEFLADLHLIHDSLCNHGDHSVANATLKDLIRLVETFG
FYLMRLDIRQESTVHTEAVAELLSHLDIDYNALDENDKLALLAKHVASATIIDTQHLALK
PMTVEVLEVFNVLRELRKEISPKAFNNYVISMTHEASHVMEVLFLAHQAGLAGYNAGKPY
CDIHITPLFETIEDLEHIVPVTENLFNNATYHALLKASGNQQEIMLGYSDSAKDGGNLSS
AWSLYQAQQKIMKVADAFEIDCRLFHGRGGTIGRGGGPTHMAILSQPTGTVRGEIKFTEQ
GEVLSYKYSNSETASYELSLGVTGLMKASLCLVTDVAEDNPAHLNTMEQLAKDGESAYRL
LTDHTEGFFKLFYEATPVNEIGLLNIGSRPSHRKKGNLSKSSIRAIPWVFGWAQARLTFP
AWFGTGYALDEWAKRHGQAGLLDMYNQWPFFRALLSNIQMALYKTQLITGKEYCEIASDR
AQAMHIYNMIAEEHTRTVDYSLSVSGNPYLMAETPSIALSLQRRNPYLDPLNHIQIVLLK
RYKDENVTEQEREVWLKPLLNSINAIAAGMRNTG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtatctgcccaaactgaatctcatgacaaacagttacgcgcgcgcgttaaactg
ctgggtcaactacttggtgaagttattgaaagccaagtaggtagagctaccctcgatgca
gtagaaaaactccgtcgtggctatatccaacttcgcaaacaagacgatcccgaattacgc
caatcgctgattaattttattgaacaacaaacccccgaaaacttaattctaattattcga
gccttcaacatttattttagcttggctaacctagccgaagaagagcatcaatatcatgat
cgtcaaagccagctcaaatctgatggcccactttggatggggtccatgctgcaaacgatc
ggtgaatttaaagaagccggtttatcaagtgatgacgtatcaaagctattaagccgtatt
aaatacattccggtatttactgcccacccgaccgaatccaagcgccgcgcagttatggaa
aacctgcgtcgtattttcgtgacgctagacggtctcaatgaagcagaaacacacaataac
agctataccaaacaagacgttattgataagctgcgttaccaaattcaggtactctggaaa
actgacgaggttcgccagtcaaaaccaacggtaagtgatgaaattcgcaacggtatctac
tacttccgtcagtccttattccaatcagtgcctcaggtttaccgctatcttgagcgagcc
cttagccgtcactatcccgatattgcccaccaagttccaccttttctatcttttggttca
tggattggcggcgatcgagatggcaacccgtttgttacccatcaaaccactcgtgaagcg
atttaccttcaatctcgctccgtactttatgagtatgaaaaacgcttgcttgaactaagc
gcaatgctgacgcattcacgccacatatgtgacattcaccaggacgtgatcaatcgtgcg
acgattgtcgatgccgatttgcttgaaaaggtctttcacaaacgcgcagaacgctttaaa
gatgaaccctatcgccgtttcttatacttgatgcgtggtcggatcagagaaaatttggcc
tatatcgaagcgcgactaaacaatgaacaaccccagtcttcgtcacgctttgcttatagc
tcagaagatgagtttttggctgacttacacttaatccatgattcgttgtgtaatcacggg
gatcatagtgtagcgaatgccaccttaaaagacttgattcgcttagtggaaacctttggc
ttttatttaatgcgcttggatattcgtcaagagtccactgtgcataccgaggcggttgcc
gagttattgagtcatcttgatattgactacaatgccttagacgaaaacgacaaattagct
ctgcttgctaagcatgttgcttcagctaccattattgatacccagcatctggcattgaag
ccgatgaccgtggaagtgctcgaagtctttaatgtgctacgcgaactgcgcaaagaaatc
agccctaaagcctttaataactatgtcatctccatgactcatgaagccagtcatgtcatg
gaagtgttatttttagcgcatcaagcaggcctggcaggctataacgcaggcaagccctat
tgtgacattcatatcaccccactgtttgaaaccattgaagatttagaacacatcgttccg
gtaaccgaaaacctatttaacaacgcaacctatcatgcgttattaaaagccagcggcaac
caacaagaaatcatgttgggctattctgattcggccaaagatggcggcaatctttcatcg
gcttggtcgctttatcaagcgcagcaaaaaatcatgaaagtggctgatgcgtttgaaatt
gactgtcgtttgtttcatggccgcggtggcacaattggtcgcggcggcggtccaacccat
atggcgatcttgtcacaaccgactgggacagtgcgcggtgaaattaaatttaccgagcag
ggtgaagtattgtcatacaaatacagcaactctgaaacagccagctatgaattgtccttg
ggcgtaactggcctaatgaaagcatcactctgtttggttacggatgtggcagaagataat
ccggcccatctaaacaccatggagcaacttgccaaagatggtgagtcggcctaccgccta
ctgaccgatcataccgaaggtttctttaagctgttttatgaagctacaccagttaatgaa
attgggttactgaatattggctcaagaccttcgcatcgtaaaaaaggtaacttgtctaaa
tcatcaatacgcgccattccgtgggtattcggttgggcacaagcacgcttaaccttcccg
gcttggtttggcacaggctatgcgctagatgaatgggcgaaacgccatggtcaagcaggc
ctgctagatatgtataaccaatggccatttttccgcgcattattgagtaacattcaaatg
gcgttgtacaaaacgcaattaattaccggtaaagaatattgtgaaattgccagtgatcga
gcgcaagccatgcacatctataacatgattgctgaagaacatacccgcaccgttgactat
tcattatcggtgagcggcaatccttacttgatggctgaaaccccatctattgccttgtct
ttacaacgccgcaacccctatttggatccacttaatcatatccaaatcgtattgctaaaa
cgttacaaagacgaaaatgtcactgagcaagaacgagaggtttggcttaaaccccttctt
aacagcattaacgcaattgcagcgggtatgcgcaataccggctag

DBGET integrated database retrieval system