KEGG   Thiomicrospira aerophila: THIAE_03355Help
Entry
THIAE_03355       CDS       T03589                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00480  Glutathione metabolism
tao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    THIAE_03355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tao02000]
    THIAE_03355
Enzymes [BR:tao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THIAE_03355
Transporters [BR:tao02000]
 Other transporters
  Pores ion channels [TC:1]
   THIAE_03355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_N_4 Tom37 Glutaredoxin HNF-1B_C
Motif
Other DBs
NCBI-ProteinID: AHF00946
UniProt: W0DVP4
LinkDB All DBs
Position
706817..707485
Genome map
AA seq 222 aa AA seqDB search
MPKLKLISFKLCPYVQRTVITLLTKNVPYEIDYIDLNNPPAWFKALSPLGKVPVMQVNDD
QVLFESSVIQEYVDEITPPSLHPVDPLVKAKNRAWIAFGGELMGMNGLHGIVHEQDQQAC
DQIIASIRGLLERLEQVHSGERFFNGATFNLIDAAYAPMLMRFELLKSHCDLDVLEGLPK
LQAWQRELMTLDAVQNSVVPELPQLYRGMISHYDGVMAKRLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atccctaaacttaaattaatcagctttaagctttgtccttatgtgcaacgtaccgtgatt
accttgctcactaaaaacgtgccttatgaaattgattacattgacttaaataacccaccc
gcctggtttaaagcgctttcccccctaggcaaggtgccggtcatgcaggttaatgacgat
caagtgctatttgaatcgtcggttattcaagaatatgttgatgaaattaccccacccagt
ttgcatccggttgatccgttggttaaggccaaaaaccgcgcgtggattgcgtttgggggc
gagctaatgggtatgaatggcttgcatggcattgttcatgaacaagatcagcaggcctgc
gaccagattattgcctcgattcgtggtttacttgagcgcttggagcaggtgcattcgggt
gagcgcttttttaatggcgcgacatttaatttgattgatgccgcttatgcgccgatgtta
atgcgttttgagttgctaaaaagccattgtgatttagatgtgcttgaagggctgcctaag
ttgcaggcctggcagcgtgaactgatgacactagatgcggtacagaactcagtggtacct
gaattaccgcaactttatcgcggcatgattagtcactatgacggcgtgatggcgaagcgt
ttaaaataa

DBGET integrated database retrieval system