KEGG   Thiomicrospira aerophila: THIAE_05080Help
Entry
THIAE_05080       CDS       T03589                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
tao  Thiomicrospira aerophila
Pathway
tao00910  Nitrogen metabolism
tao02010  ABC transporters
Module
tao_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    THIAE_05080
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    THIAE_05080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tao02000]
    THIAE_05080
Transporters [BR:tao02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    THIAE_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2929
Motif
Other DBs
NCBI-ProteinID: AHF01251
UniProt: W0DWM0
LinkDB All DBs
Position
complement(1041410..1042228)
Genome map
AA seq 272 aa AA seqDB search
MSNIASQERIKNYGQYAKNHVAPPLLVLIVLLLLWEWLTSGATATLPSPTRVLSETWELI
INPFYDHGGNDVGMGWQILASLERVAYGFTLAVIVGVSLGVLVGQSTLAMRGLDPIFQVL
RTVPPLAWLPLSLAGFQHSDPSAIFVIFITAIWPIIINTSVGVRNISEDYRNVARVLNLN
GYEYFTKIMLPAAAPYIFSGLRIGVGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSQISEI
VLALIYVGIVGFILDRMVAFVGNKVTRGTSAS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatcgcatcgcaagagcgcatcaaaaattatggccagtatgctaaaaaccat
gtagcaccaccattactggttcttatcgttttattactactttgggaatggctaacttcg
ggagcaactgcaacactgccatccccgacccgagtattgtcggaaacctgggagttaatc
atcaaccctttttatgatcatggtggtaatgatgtagggatgggttggcaaatcttagcc
agtcttgaacgtgtagcctatggttttaccctagcggtgattgtaggggtcagtttgggc
gttctggtgggtcagtctaccctagctatgcgcggtcttgatcctatctttcaagtattg
cgcactgtaccgcctttggcttggttgccactatccttggctggttttcagcatagtgat
ccatcagccatttttgtaatctttatcaccgcgatttggcccattattatcaacacatcg
gtaggggttcgaaatatttccgaagattatcgcaatgtcgcacgtgtgcttaatctaaat
ggttatgagtatttcactaaaatcatgcttcctgctgctgcaccctatattttctctggg
ttgcggatcggtgttggtttgtcttggttagcgattgttgcagctgaaatgttgattggt
ggcgtagggattggcttctttatctgggatgcttggaactcatcgcaaattagtgaaatt
gtattggcactgatctatgtgggtatagttgggtttattttggatcgaatggtggccttt
gtgggcaataaagtaacccgcggcacatcagcaagctaa

DBGET integrated database retrieval system