KEGG   Terribacillus aidingensis: GZ22_03450Help
Entry
GZ22_03450        CDS       T03216                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
tap  Terribacillus aidingensis
Pathway
tap00627  Aminobenzoate degradation
tap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tap00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GZ22_03450
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     GZ22_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIF65792
UniProt: A0A075LIN8
LinkDB All DBs
Position
632143..633603
Genome map
AA seq 486 aa AA seqDB search
MENFKHVNSQYINGEWREGQSSVKMENRNPYNGELIATYQAANLDDLNEAYEASARVQKE
WAKTNPVAQRAVFEKAVAYLEANHEAFVETIIEEIGGTRLKAEFEIGLVTNIIKEASTFP
FRMNGQILPSPIDGKENRVYRVPVGVVGIISPFNFPFFLSMKSVATALAAGNGVVLKPHE
HTAITGGTMIAKLFEEAGLPKGLLNVIVTEISEIGDNFVEHRIPRAVSFTGSTKVGKHIG
MVAGKNLKEAHLELGGNSALVVLEDADMELAVSAAVFSRFTHQGQICMSANRLIVHEDVY
DEFVEKYLAKVSTLTCGDPKDPSTIIGPLINEQQVKTTVALIEKGIEEGATPLIKGKVEG
NIVEPVVFGDVTPDMTLANEELFAPVVSILKVKSDEEVLAYANNSDYGLSGAIHTRDVER
GAELAKQMDTGMIHINDGTINDEPTVAFGGVKNSGLGRLNGEWSLDAFTTTKWISIQHDR
RQYPYS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttcaaacacgtaaacagtcagtatattaacggagaatggcgtgaaggacag
agcagcgtgaaaatggagaaccgcaatccatataacggtgagcttatcgctacttatcaa
gctgccaacttggatgatttgaatgaagcgtatgaagcatctgcccgagttcagaaagaa
tgggcgaaaacaaacccggtagcacagcgcgctgtcttcgaaaaagcggttgcttacctt
gaagcaaaccacgaagcatttgttgagactatcattgaggagattggcggtacaagactg
aaagctgagttcgaaatcggtcttgttacaaatatcatcaaggaagcatctacattccca
ttccgcatgaacggccaaattttgccgtccccgattgatggcaaggaaaaccgtgtttat
cgtgtaccggttggagttgtggggattatcagcccattcaacttcccgttcttcctatct
atgaaatctgtcgctactgctttagcagctggaaatggtgtggtattgaaaccgcatgaa
catacagcaattactggcggtacgatgattgcgaagctattcgaggaagcgggtcttcca
aagggcttgctgaatgtcattgtgactgaaatcagtgaaattggtgataactttgtagag
caccgaattccgcgtgccgtttccttcacaggatctactaaagtcggtaaacatatcgga
atggtagccggtaagaatttgaaagaagcacatctggagcttggcggtaatagtgcattg
gtagttttagaggatgcggatatggaacttgcagtcagtgcagctgtattcagccgtttc
actcaccaaggtcagatctgtatgtctgctaaccgtcttatcgtacatgaagatgtatat
gatgaattcgttgaaaaatatttggcgaaggtttccacgcttacttgcggtgacccgaaa
gatccaagcacaatcatcggacctcttatcaacgaacagcaagtaaaaacaactgtagcg
ttgattgaaaaaggtatcgaagaaggtgcaacacctttaatcaaaggtaaagtggaaggc
aacattgttgaaccagtagtatttggtgatgtgacaccagatatgacacttgcaaacgaa
gaactgtttgcacccgttgttagtattctgaaagtgaaaagtgatgaagaagtgttggct
tatgcaaataacagtgattatggcttaagcggtgctatccacacaagagacgtggagcgc
ggtgctgagcttgcgaaacaaatggatactggtatgattcatatcaacgatggtacgatc
aatgatgaacctacagtcgcatttggcggcgttaagaactccggtcttggtcgactgaat
ggcgagtggagtcttgatgcattcacaacgacaaaatggattagcatccagcacgatcgc
agacaatatccatatagctaa

DBGET integrated database retrieval system