KEGG   Terribacillus goriensis: GZ22_04540Help
Entry
GZ22_04540        CDS       T03216                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tap  Terribacillus goriensis
Pathway
tap00020  Citrate cycle (TCA cycle)
tap00310  Lysine degradation
tap00380  Tryptophan metabolism
tap01100  Metabolic pathways
tap01110  Biosynthesis of secondary metabolites
tap01120  Microbial metabolism in diverse environments
tap01130  Biosynthesis of antibiotics
tap01200  Carbon metabolism
Module
tap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GZ22_04540
  09105 Amino acid metabolism
   00310 Lysine degradation
    GZ22_04540
   00380 Tryptophan metabolism
    GZ22_04540
Enzymes [BR:tap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GZ22_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 RnfC_N PYNP_C HlyD_D23 MerR-DNA-bind
Motif
Other DBs
NCBI-ProteinID: AIF65970
UniProt: A0A075LH12
LinkDB All DBs
Position
844659..845924
Genome map
AA seq 421 aa AA seqDB search
MKELKVPELAESITEGTISEWLVNPGDHVEKGDPVLELETDKVNVEVNAEYSGVVKELLK
EAGDDVEVGDIIATVDENGEAGGEADTSAAEETKAEAAAVAEAPAEEKKEETKVEAAEPA
AANKNTLATPAARKRARELGISLDEISARDPFGRVRPEDVEEAAKPKEKPAKQAKDDKPK
KSAKTEFEKPVERVKMTRRRQTIANRLVEAQHTSAMLTTFNEVDMTAVMQLRSQRKDKFL
EKHDVKLGFMSFFTKAVVGALKEFPYINAEIQDNEIVLKKFYDVGIAVSTDDGLVVPVVR
DADRLDFAGIESEISRLGKKARNKELSLDELNGGSFTITNGGIFGSLVSTPILNTPQVGI
LGMHTIQKRPIAMPDDTIQIRPMMYLALSYDHRIVDGKDAVQFLVRIKQLLEDPYDLLLE
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactaaaagtaccagagctggcagaatcaattacagagggaacaatctccgag
tggttagtcaatccaggtgaccatgttgagaagggagatcctgtcctcgaattggaaaca
gataaggtaaatgtggaagtcaatgcggagtatagcggtgtggtgaaggaactgttaaag
gaagctggcgatgatgtagaagtaggcgatatcattgctacggttgacgaaaatggagaa
gctggcggcgaagcagacacttctgcagctgaagagacgaaagcagaagcggcagctgta
gcggaagctccggctgaagagaagaaggaagagacaaaggtcgaagcagcagaacctgct
gcagccaataagaatacactggcaactccagcagctcgcaagcgtgctcgtgagttaggt
atcagcctggatgagatctcagcacgtgatccattcggcagagttcgaccagaagatgtt
gaggaagcagcgaaaccgaaagaaaaacctgccaagcaggccaaagatgacaaaccgaag
aagtcagcaaagacagagtttgaaaaaccagtagagcgtgtaaaaatgactcgccgccgt
caaacaatcgcaaacagactggtggaagcacagcacacatctgcaatgcttaccactttc
aatgaagtcgacatgacagcagtcatgcagcttcgaagtcaacgtaaggataaattcctt
gaaaaacatgatgtgaagcttggatttatgagcttctttacaaaagcggttgtcggggca
ttgaaggaattcccttacatcaatgctgaaattcaggataatgaaattgtgctgaagaaa
ttctacgatgttggtatagctgtatctaccgacgatggactagttgttccagtcgtgcgg
gatgctgatcgactagactttgcaggcattgaaagcgagatttcccgattaggcaagaaa
gcccgtaacaaagagttaagcttggatgaactgaacggtggctcatttactattacaaat
ggcggtatttttggttcactcgtttctacaccgatactaaatacaccacaagtcggtatc
ctagggatgcatacaatccagaaacgtccaattgccatgccggatgatacaatccagatt
cgtccgatgatgtaccttgcactttcctacgatcatcgtatcgtcgatggaaaagatgca
gtccagttccttgtacgtatcaagcaattgcttgaagatccatacgatctccttttggaa
ggttaa

DBGET integrated database retrieval system