KEGG   Terribacillus goriensis: GZ22_04965Help
Entry
GZ22_04965        CDS       T03216                                 

Definition
(GenBank) competence protein
  KO
K02250  competence protein ComK
Organism
tap  Terribacillus goriensis
Pathway
tap02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tap00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GZ22_04965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tap03000]
    GZ22_04965
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tap02044]
    GZ22_04965
Transcription factors [BR:tap03000]
 Prokaryotic Type
  Other transcription factors
   Others
    GZ22_04965
Secretion system [BR:tap02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   GZ22_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK FlbD
Motif
Other DBs
NCBI-ProteinID: AIF66045
UniProt: A0A075LH91
LinkDB All DBs
Position
926833..927357
Genome map
AA seq 174 aa AA seqDB search
MQQIEQNPTMAELTPLTMAVLPKLLDNGQAGCEVIETEDSFTFRTPPSRFIDLACKFYGS
SLKGRQAGVKDICGITHKAPISIDPVSGMYFFPTSSPLSHACSWISHSHIKRIEAAPHQR
TTLTFKNGHTLILDVSYGSMMNQVQRTAQYRFLLDKRIRHLWKYGGDQIAEPFV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagatagaacaaaatccaaccatggcagaacttacgccgcttacaatggctgta
ctgccaaagctcctcgacaatggtcaagcaggttgtgaagtaatcgagactgaagatagt
tttacttttcgcacccctccgagcagattcatcgatttggcctgcaagttctatggaagt
agcttaaaaggaaggcaggcaggtgtgaaagatatatgtggaatcactcataaggccccg
atatcgatagaccctgtcagcggtatgtatttctttcccacctcttcaccactctcccat
gcatgctcctggatctctcattcccacatcaagcggatagaagccgccccgcatcagcga
acaaccctcacatttaagaatggccatacactcatccttgatgtttcttatggatccatg
atgaaccaggtccagcgtactgcgcaataccgatttctgctggataagcggatcaggcat
ttgtggaagtatggcggggaccagattgcggagccttttgtgtaa

DBGET integrated database retrieval system