KEGG   Terribacillus goriensis: GZ22_13505Help
Entry
GZ22_13505        CDS       T03216                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tap  Terribacillus goriensis
Brite
KEGG Orthology (KO) [BR:tap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GZ22_13505
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GZ22_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Thi4 FAD_binding_3 AlaDh_PNT_C DAO K_oxygenase NAD_binding_8 Glutaredoxin Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AIF67548
UniProt: A0A075LSV0
LinkDB All DBs
Position
complement(2575693..2577222)
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMALMENPIVLKVSAGADDVSKEMLSLVEELADMSSKITVEKAELTR
TPSFTVNRVGEDTGIAFAGIPLGHEFTSLVLALLQVSGRAPKVDEKLINQIKNIKGEFHF
EAYISLTCHNCPDVVQALNVMSVLNPNITSTMIDGAAFKEEVESKNIMAVPTVYLNGENF
GSGRMTLEEMLAKMGSSADASEFDNKDPYDVLVVGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVLDTMSIENFITVKETEGPKLVASLEEHVKEYNIDVMNLQKATKIAKNDLFELELE
NGATLKSKSVIISTGARWRNINVPGEQEYKNKGVAYCAHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFADTLKADEVLQKRAYSLPNVTIITNAQTTEITGDDNVNGITY
VERDTNEEKHIALQGVFVQIGLVPNTEFLADVVERTPMGEIIVDKHGQTNVPGLFAAGDC
ADTAYKQIIVSMGSGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgatgcaaacataaaagctcaattaaaccaatacatggcgcttatggagaac
cctatcgttcttaaagtgagcgcaggtgcagacgacgtttctaaggaaatgctttctctc
gtagaagagcttgcagacatgtcgtctaagatcacagtcgaaaaagcagaacttacacgt
accccgagcttcaccgtgaaccgtgttggcgaagatacaggcattgcttttgctggtatc
ccgcttggacatgagttcacttcgctcgtacttgctctcttgcaggtaagcggtcgtgca
ccgaaggttgatgagaagctgatcaaccagatcaagaacatcaaaggtgaattccacttt
gaggcttatatcagcctgacttgtcataactgcccggatgtcgtacaagcattgaacgtg
atgagcgtactaaatccgaacatcacaagcacgatgattgatggtgcagccttcaaggaa
gaagtggaaagcaagaacatcatggcagttccgactgtttatttgaacggcgagaacttc
ggcagcggccgtatgactcttgaagaaatgctagcgaaaatgggctctagtgctgacgca
tccgagttcgacaacaaagatccatatgacgttcttgttgtcggcggcggtccagctggc
tccagcgctgctatctatgctgcccgcaaaggaatccgcactggtatcgtagcggaacgt
tttggcggtcaggtattggatacgatgagcatcgagaacttcatcaccgtcaaggagaca
gaaggtccgaagcttgttgcaagcctggaagagcatgtgaaagaatacaacatcgatgta
atgaacctgcagaaagcaacgaaaatcgcgaaaaacgatttatttgagcttgagctggaa
aacggcgcaacactaaaaagtaagagcgtcatcatctctacaggtgcacgttggcgcaac
atcaacgttcctggagaacaagaatacaagaataaaggtgttgcctactgcgcacactgt
gacggcccgctattcgaaggaaaagacgtcgctgtcatcggcggcggtaactccggtatt
gaagctgccattgatttggctggtatcgtaaaccatgttactgttcttgaatttgccgat
acattgaaagcagacgaagtattgcaaaagcgtgcttacagcctgccgaatgtaacgatc
attacaaatgcgcaaacaacagagattactggtgacgataacgtcaacggtatcacctac
gtagaacgcgatacaaacgaagaaaaacacattgccttgcaaggtgtcttcgtccaaatc
ggtcttgtaccgaatacagaatttcttgctgacgtcgttgagcgcactccaatgggtgaa
atcatcgtcgacaaacacggccaaacgaatgtcccaggcttgtttgctgcaggagactgt
gcagatacagcatataaacaaatcattgtttctatgggttctggtgcgacagcatcgctt
ggtgcatttgattatttaattcgaaattaa

DBGET integrated database retrieval system