KEGG   Terribacillus goriensis: GZ22_14160Help
Entry
GZ22_14160        CDS       T03216                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tap  Terribacillus goriensis
Pathway
tap00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GZ22_14160
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GZ22_14160
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GZ22_14160
    1.1.1.-  
     GZ22_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C TrkA_N ADH_N_assoc PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AIF67667
UniProt: A0A075LNV9
LinkDB All DBs
Position
2723870..2724913
Genome map
AA seq 347 aa AA seqDB search
MKALRWHNQKDVRLEDIDEPVIKPNQVKMKVKWCGICGSDLHEYLGGPIFIPVDNPHPLT
GEVAPVTMGHEFSGEVVEVGPEVKDYQVGDRVVVEPIFATHGHQGAYNLDKQMGFLGLAG
GGGGLSEYVAVDEELLFKLPDSLSYEQGALVEPSAVALYAVRSSKVKAGDKVAVFGCGPI
GLLVIEALKAAGATEIYAVELSPERQAKAEELGAIVVDPSKVDDTVEEIRRLTNGGVEVA
FEVTGVPVVLRQAIQSTDIGGETMIVSIWEKPAEIMPNDIVIQERSIKGIIGYRDVFPQV
LSLMEKGYFSAEKLVTKKIKLDEVVEEGFESLIKEKNQVKILVQSEQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgcgttggcataatcagaaagatgttagattagaagatattgatgaacct
gtcatcaaaccgaatcaagtaaaaatgaaggtaaaatggtgcggtatctgcggaagtgac
ttacacgaatatctcggtggaccaattttcattccggttgataatccgcatccactgact
ggcgaagtggctccagtgacaatgggacatgaattttctggtgaagtagttgaagtagga
ccagaagtgaaagattaccaggttggcgaccgggttgtggtggaaccaatctttgccacg
catggacatcagggtgcatataacttggacaagcaaatgggcttccttggacttgctggc
ggtggcggcggtttgagcgaatatgttgccgtagatgaagagcttctgttcaagctgccg
gattctttaagctatgagcaaggcgcattggtagagccttctgcagttgcgttgtatgcg
gtacgttccagcaaagtaaaagcaggggacaaggtagctgtattcggttgtggcccaatc
ggattgctggttatcgaagctttgaaagcagcaggtgcaactgaaatttatgcagttgaa
ctatcaccagaaagacaagcaaaagcagaagaactaggagcaattgtcgtcgatccaagc
aaggtggatgatacagttgaggaaatcagaagattgactaacggtggtgtagaggttgcc
tttgaagttacaggcgtaccagtcgtcttacggcaggcgatccagtctactgatatcggc
ggcgaaacaatgatcgtcagcatttgggaaaaaccagctgagatcatgccaaatgatata
gttattcaagaacgttctattaaaggtatcattggatatcgggatgttttcccgcaagtc
ctttccttaatggaaaaaggctacttctcagctgagaagctagttactaagaaaattaag
ctggacgaagtggtagaagaaggatttgaaagcttgatcaaggagaagaaccaagtgaag
atccttgttcaatctgagcaataa

DBGET integrated database retrieval system