KEGG   Thermus aquaticus: TO73_0098Help
Entry
TO73_0098         CDS       T04117                                 

Definition
(GenBank) lysine biosynthesis protein LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
taq  Thermus aquaticus
Pathway
taq00300  Lysine biosynthesis
taq01100  Metabolic pathways
taq01210  2-Oxocarboxylic acid metabolism
taq01230  Biosynthesis of amino acids
Module
taq_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:taq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    TO73_0098
Enzymes [BR:taq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     TO73_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 CPSase_L_D2 GSH-S_ATP ATP-grasp ATPgrasp_ST ATP-grasp_5 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ALJ89963
UniProt: B7A8X4
LinkDB All DBs
Position
73140..73985
Genome map
AA seq 281 aa AA seqDB search
MLAILYDRIRPDEKMLFERAEALGLPFKKVYVPALRMVLGERPKELEGVTVALERCVSQS
RGLAVARYLTALGIPVVNRPEVIETCGDKWATSVALERAGLPQPKTALLTEAEEALKLME
AWGYPVVLKPVIGSWGRLLAKITDREAAEAILEHKEVLGGFQHQLLYIQEYVKKPGRDIR
VFVVGERAIAAIYRRSQHWITNTARGGQAENCPVTPEIAELSLRAAQAVGGGVVAIDLFE
SERGLLVNEVNHTMEFKNSVHTTGVDIPGEILRYAWEVAGG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctggccatcctttacgaccgcatccgccccgacgagaagatgctctttgagcgggcc
gaggccctgggcctccccttcaaaaaggtctacgtccccgccctgcgcatggtgctgggg
gagaggcccaaggagctggaaggggtcaccgtggccctggagcggtgcgtgagccaaagc
cgcggcctggccgtggcccgctacctgaccgctttgggcatccccgtggtcaaccggccc
gaggtcatagagacctgcggggacaagtgggccaccagcgtcgccctggagcgggcgggc
ctgccccagcccaagaccgccctcctcaccgaggccgaggaggcccttaaactcatggag
gcctggggctaccccgtggtcctaaagccggtgatcgggagctgggggcgcctccttgcc
aagatcaccgaccgggaggcggcggaggccatcttggagcacaaggaggtcctgggaggc
ttccagcaccagctcctttacatccaggagtacgtgaagaagcccggccgggacatcagg
gtcttcgtggtgggggagagggccatcgccgccatctaccgcaggagccagcactggatc
accaacaccgcccggggcgggcaggcggaaaactgccccgtcacccccgagatcgccgag
ctttcgctgcgggccgcccaggcggtggggggcggggtggtggccatagacctctttgag
tcggagaggggccttctggtcaacgaggtgaaccacaccatggagttcaagaactccgtg
cacaccacgggggtggacatcccgggggagatcctgaggtacgcctgggaggtggccggt
ggctag

DBGET integrated database retrieval system