KEGG   Thermus aquaticus: TO73_1126Help
Entry
TO73_1126         CDS       T04117                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
taq  Thermus aquaticus
Pathway
taq00620  Pyruvate metabolism
taq00680  Methane metabolism
taq00710  Carbon fixation in photosynthetic organisms
taq01100  Metabolic pathways
taq01120  Microbial metabolism in diverse environments
taq01200  Carbon metabolism
Module
taq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:taq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TO73_1126
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TO73_1126
   00680 Methane metabolism
    TO73_1126
Enzymes [BR:taq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TO73_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALJ90973
UniProt: B7A7J1
LinkDB All DBs
Position
complement(1005755..1008328)
Genome map
AA seq 857 aa AA seqDB search
MTEPFELLKAEVDLLGRLLGEAIRRVSGERFFALVEEVRLLAKARRQGDEGAGEALWKRV
GTLSTEEAEALVRAFTHYFHLVNLAEERHRVRVNRMRAQAETPENPRPEGFLALAQALKG
RGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLEALQGELEEGERTRLEARVALLY
ATEEVRKARPSVEDEIKGGLYYLPTTLWRAIPKVVEGLETALERVYGKRPRLKSPVRFRS
WIGGDRDGNPFVTPEVTRFAARYAREVAKEKVLEELGALVRDLSLSEAKVPVPREVRAGG
EGVERFPGEPYRRFFAQIYRKVSQDEATTEELLSALKVAEGGLRAVGLEEVGKSFLRPLE
ARLSAFGLELAPLDLREESGKLLLAAAELLRLGGVHPDFLSLSPEAQEALLTEELKTARP
LLPVGEEPQEEALRVALGALRAWRDKGAHVVSMTHHPADLLSVFLLAREVGLYRPGKPLP
FDVVPLFETLEDLRRAPLVLRRLLENPVFLAHARGRGGVEVMIGYSDSNKDAGFLMANLA
LYEAQEALSRVGEERGLPVHFFHGRGTSTARGGGPAGRAIASLPPRSVGRRLRLTEQGEA
LADRYGHPDLAVRHLEQLLFHFAQAALGDGVEPKPHWREALSWAGERSMAHYRALLAEEG
FFPFFEALTPIREIGELPIASRPVYRHGRVRDIGDLRAIPWVMAWTQVRLLLPGWYGLST
LEELPLELLREMYREWPFFATTLESAAMALAKADLGVARLYLRLVPEALHPLFHRIAEEY
LRTQALLEAIFQAPLLHNQRTLERQIALRNPYVDPINIVQVELLRRYRAPGGREDEALRK
ALLLSILGVAAGLRNAG
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccctttgagcttttgaaggcggaggtggacctcctgggccggctcctgggg
gaggccatccggagggtttccggggagaggttcttcgccctggtggaggaggtgcgcctc
ctggccaaggccaggcggcagggggacgagggggcgggggaggcgctttggaagcgggtg
gggaccctctccacggaggaggccgaagccctggtgcgggccttcacccactacttccac
ctggtgaacctggcggaggagcgccaccgggtgcgggtgaaccggatgcgggcccaggcg
gagacccccgagaaccccaggcccgagggctttttggccctggcccaggccctgaagggg
cgggggctttccctggaggaggccgaggcccacctgaaccggctggagctcctcctcacc
ttcaccgcccaccccacggagacccgccgccgcaccctgcgccaccacctggaggcctta
cagggggagctggaggagggggagaggacccggctcgaggcccgggtggccctcctctac
gccaccgaggaggtgcgcaaggccaggcccagcgtggaggacgagatcaagggggggctt
tactacctgcccaccaccctctggcgggccatccccaaggtggtggaggggctggagacc
gccttggagcgggtctacggcaagagaccccgcctcaaaagccctgtccgcttccggagc
tggatcggcggggaccgggatgggaaccccttcgtgacccccgaggtcacccgtttcgcc
gcccgctacgcccgcgaggtggccaaggagaaggttctggaggagctgggggccttggtg
cgggacctctccctttccgaggccaaggtgcccgtgccccgggaggtgcgggcggggggc
gagggggtggagcggttccccggagagccctaccgccgcttcttcgcgcaaatctaccgg
aaggtttcccaggacgaggccaccaccgaggagctcctttccgccctgaaggtggcggaa
ggggggcttagggccgtggggcttgaggaggtggggaagagctttttgcgccccctcgag
gcccgcttgagcgccttcggcctggagctcgcccccctggaccttcgggaggagtcgggg
aagctcctcctggccgccgccgagctccttcgcctgggcggggtccacccagacttccta
agcctttcccccgaggcccaggaggccctcctcaccgaggagctgaagacggcaaggccc
ctcctccccgtgggggaggagccccaggaggaggccctgagggtggccctgggggcccta
cgggcctggcgggacaagggggcccacgtggtctccatgacccaccaccccgccgacctc
ctcagcgtcttcctcctggcccgggaggtggggctctaccgcccggggaagcccctcccc
tttgacgtggtccccctctttgagaccctggaggacctcaggcgggcccccttggtcctc
cgccgcctcctggagaaccccgtcttcctggcccacgcccggggccggggcggggtggag
gtcatgatcggctactccgactccaacaaggacgccggcttcctcatggccaacctggcc
ctctacgaggcccaggaggccttaagccgggtgggggaggagcgggggcttcccgtccac
ttcttccacggccggggcacctccaccgcccgggggggcggcccggcgggccgggccatc
gccagccttcccccaaggagcgtgggccgccgcctccgcctcacggagcagggggaggcc
ctggcggaccgctacggccaccccgatctggccgtgcgccacttggagcagcttctcttc
cacttcgcccaggccgccttgggggacggggtggagcctaagccccactggcgggaggct
ctctcttgggcgggggagaggagcatggcccactaccgggccctcctggcggaagagggc
tttttccccttctttgaggccctcacccccatccgggagatcggggagctccccatcgcc
agccgccccgtctaccgccacggccgggtgcgggacatcggggacctgagggccatcccc
tgggtcatggcctggacccaggtgcgcctcctcctgccgggctggtacggcctctccacc
ttggaagagcttcctttggagcttctaagggagatgtaccgggaatggcccttcttcgcc
accaccctggagagcgccgccatggccctggccaaggcggacctgggggtggcccggctc
tatttgcgcctggtgcccgaggccctccatcccctctttcaccggatcgccgaggagtac
ctccgcacccaggccctcctggaggccatcttccaggcccccctcctccacaaccaaagg
accttggagcgccagatcgccctcagaaacccctacgtggaccccatcaacatcgtccag
gtggagctcctaaggcgctaccgcgcccccggggggcgggaggacgaggccttgaggaag
gccctgctcctctccatcctgggggtggcggcgggcctcaggaacgcggggtaa

DBGET integrated database retrieval system