KEGG   Thermus aquaticus: TO73_1506Help
Entry
TO73_1506         CDS       T04117                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
taq  Thermus aquaticus
Brite
KEGG Orthology (KO) [BR:taq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:taq03016]
    TO73_1506
Enzymes [BR:taq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     TO73_1506
Transfer RNA biogenesis [BR:taq03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    TO73_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: ALJ91345
UniProt: B7A7Y9
LinkDB All DBs
Position
complement(1357818..1359614)
Genome map
AA seq 598 aa AA seqDB search
MLVKKALVIYKGKPALAEEKGDRLELTLEGGEKLKVRPKDVLFLHPGPSRLELRVPEGEE
EAAWELLEGQKVSLKELAELAFGAYTPEAAYGAYLLAQKGERFVLEGGEVRARTREELAS
LEEMKRRKEERERAFGEAVERIRQGRPSLEDRPLLAEVEALAYGERKESRLLKALGLPET
PEAAHGLLLRLGLWRRENPHPRRLGLPLAPPDLPVPPLPEEERVDLTHLPAFAIDDEGSQ
DPDDALYAERVEEGFRLFVHVADVAALVGPGSPLDGEALRRGANLYLPEGAVPMLPLAVT
EALGLGLKEVSPALTFELLVSPEGELLREDLYLSWVRVRRLSYREALEVEALAPMKALAE
AFLRKRLAQGALDIALPEVKVRVEGEEIRITPLPLYESRVWVREAMLLAGYAAAHLALRE
GLPFPFATQEAPSHRVEGEGLAAMWAQRKALKRAQLKAVPAPHRGLGLPLYAQVTSPLRR
YLDLVAHQQLRAWLKGERPLSQGEVLERVGAAEAVADLVREGERRSKLHWTLLYLMEKGY
EGPGVLVERRGGQGVFLLPELGLTAQVALSGPLALNAEVRLRFLEADLPALEARFALV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcaagaaggccttggtcatctacaaaggcaagcccgccctggcggaggagaag
ggggaccgcctagagctcaccctagaaggcggggagaagctcaaggttcgccccaaagac
gtgctttttcttcaccccggcccctcccgcctggagcttagggtgcccgagggggaggag
gaggcggcttgggagcttcttgaggggcagaaggtgagcctgaaggagctcgccgagctg
gccttcggggcctacacccccgaggccgcctacggggcctacctcctggcccagaagggg
gagaggttcgttctggagggcggcgaggtccgggcccgcacccgggaggagctggcctct
ctggaggagatgaaaaggcgtaaggaggagagggagcgggcctttggggaagccgtggag
cggatccgccagggacggccctccctcgaggaccgccccctcctggccgaggtggaggct
ctggcctacggggagaggaaggaaagccgcctcctcaaggccctgggccttcccgaaacc
cccgaggccgcccacggcctccttctccgcctgggcctctggcggcgggaaaacccccac
cccaggcggcttggccttcccctggccccgccggacctccccgttccccccctgcccgag
gaggagcgggtggacctcacccacctccctgccttcgccattgacgacgaggggagccag
gacccggacgacgccctttacgccgaaagggtggaggagggcttccgccttttcgtccac
gtggccgatgtggccgctttggtcgggccgggaagccccctggacggggaggccctccgc
cggggggccaacctctatctgcccgagggcgcggtgcccatgctccccctggcggtgacc
gaggccctgggcctggggcttaaggaggtctccccagccctcacctttgagcttctggtc
tccccggaaggggagcttttgcgggaggacctttacctctcctgggtgcgggtgaggcgg
ctttcctaccgggaggccctcgaggtggaggccctggcgcccatgaaggccttggcggaa
gcctttttgcggaagcgcctggcccagggggctttggacatcgccctgcccgaggtcaag
gtgcgggtggagggggaggagatccggatcaccccccttcccctttatgaaagccgggtc
tgggtgcgggaggccatgctcctcgccggctacgccgccgcccacctggccctgagggag
ggccttccctttcccttcgccacccaggaggccccttcccaccgggtggagggggagggg
cttgccgccatgtgggcgcagcggaaggccctgaagagggcgcagctcaaggccgtcccc
gccccccatagaggcctcggccttcccctctacgcccaggtgacgagccccttaaggcgc
tacctggacctggtggcccaccagcagcttagggcctggctcaagggggaaaggcccctt
tcccagggggaggtcctggagcgggtgggggcggcggaggcggtggccgacctggtgcgg
gaaggggagaggcggagcaagctccactggaccctcctctacctgatggaaaagggctac
gagggcccgggcgtcctggtggagaggcgggggggacagggggtcttcctcctcccggag
ctgggcctcaccgcccaggtggccctctccggcccccttgccctcaacgccgaggtccgc
ctccgcttcctggaggccgaccttccggccctcgaggcccgcttcgccctggtctaa

DBGET integrated database retrieval system