KEGG   Thermus aquaticus: TO73_1768Help
Entry
TO73_1768         CDS       T04117                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
taq  Thermus aquaticus
Pathway
taq00020  Citrate cycle (TCA cycle)
taq00270  Cysteine and methionine metabolism
taq00620  Pyruvate metabolism
taq00630  Glyoxylate and dicarboxylate metabolism
taq00680  Methane metabolism
taq00710  Carbon fixation in photosynthetic organisms
taq01100  Metabolic pathways
taq01110  Biosynthesis of secondary metabolites
taq01120  Microbial metabolism in diverse environments
taq01130  Biosynthesis of antibiotics
taq01200  Carbon metabolism
Module
taq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
taq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
taq_M00012  Glyoxylate cycle
taq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:taq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TO73_1768
   00620 Pyruvate metabolism
    TO73_1768
   00630 Glyoxylate and dicarboxylate metabolism
    TO73_1768
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TO73_1768
   00680 Methane metabolism
    TO73_1768
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TO73_1768
Enzymes [BR:taq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TO73_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ALJ91600
UniProt: B7A6J5
LinkDB All DBs
Position
1612619..1613602
Genome map
AA seq 327 aa AA seqDB search
MKSPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMRALEGVVMELEDC
AFPLLAGLEASDDPKVAFKDADYALLVGAAPRKAGMERRDLLELNGRIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLSKKTGVSVDRIRR
ITVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEEVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDFVSMAVPSQGEYGIPEEIVYSFPVTAKDGVYRIVEGLEIN
EFARKRMEITAQELLDEMAQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccccgttcgcgtggcggtaaccggcgccgcaggccagatcggctacagcctc
ctcttccgcatcgccgcgggagagatgctgggcaaggaccagcccgtcatcctgcagctt
ctggaaatcccccaggccatgagagccttggagggcgtggtcatggagctggaggactgc
gcctttcccctcttggccggcctcgaggccagcgacgaccccaaggtggccttcaaggac
gccgactacgcccttttggtgggggcggcccccaggaaggcaggcatggagaggcgggac
ctcctggagctgaacggcaggatcttcaccgagcagggccgggccctggcggaggtggcc
aagaaggacgtgaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggtctcaaccccaggaacttcaccgccatgacccgcctggaccac
aatcgggccaaggcccagctcagcaagaagaccggggtgagcgtggaccggatccgccgg
atcaccgtctggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacgggcggcccgctctggagctggtggacatggagtggtacgaggaggtcttcatcccc
accgtggcccagaggggggcggccatcatccaggcccggggggcctcctccgccgccagc
gccgccaacgccgccattgagcatatccgcgactgggccctgggcacccccgagggggac
tttgtctccatggccgtcccctcccagggggagtacggcatccccgaggagatcgtctac
tccttccccgtgaccgccaaggacggggtctaccgaatcgtggagggcctagagatcaac
gagttcgccagaaagcgcatggagatcaccgcccaggagcttctggacgagatggcccag
gtgaaggccctggggctgatctga

DBGET integrated database retrieval system