KEGG   Thermoplasmatales archaeon BRNA1: TALC_01146Help
Entry
TALC_01146        CDS       T02532                                 

Definition
(GenBank) DNA ligase I, ATP-dependent (dnl1)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
tar03030  DNA replication
tar03410  Base excision repair
tar03420  Nucleotide excision repair
tar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tar00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TALC_01146
   03410 Base excision repair
    TALC_01146
   03420 Nucleotide excision repair
    TALC_01146
   03430 Mismatch repair
    TALC_01146
Enzymes [BR:tar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TALC_01146
    6.5.1.6  DNA ligase (ATP or NAD+)
     TALC_01146
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TALC_01146
DNA replication proteins [BR:tar03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TALC_01146
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TALC_01146
DNA repair and recombination proteins [BR:tar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TALC_01146
   NER (nucleotide excision repair)
    Other NER factors
     TALC_01146
   MMR (mismatch exicision repair)
    Other MMR factors
     TALC_01146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AGI48135
UniProt: M4YM31
LinkDB All DBs
Position
1049480..1051297
Genome map
AA seq 605 aa AA seqDB search
MQFSDIAEVFDRLEHTSSRLEMTDILSDFFKRVDPRDLRQIIYLSVGRLHPDFYPQELGM
ADKLVLRAISAVSGRPQSEVDQLSIRIGDPGDIAEQLIQKKKQMTLFSEPLTFEAVIEGL
TAIETASGKDSQDRKMKHLSRMLHDSGPVEARYICRIVTGRMRVGAGSMTVMDALASAFA
NKEDRPEIERAFNITCDMGLVAETLAEGGLEAVRKIGVSVGSPIRVMLAERLRSLPDIID
RMGGKCAFEYKYDGIRVQAHIRKGDGGFVKLYSRRLEDMTSNFPDIAEALQRQLRGSEAI
IEGECVAIDPSTDNLMPFQNVTHRRKKHGMSQAVEDVPVRIFMFDLLYLDGTDYTLSPYP
KRREILEGAFDVNTDPSTYDHVGYTTRAVIDNDDDAQRFFDTAIASKCEGIIAKSLEDES
IYRAGSRGFLWIKYKKDYTQALVDSFDLTVVGAFYGMGKRAGVYGALLMAAYDPDTGKFC
TTCKLGTGFDDAFLASLPSLLDRYRSESKPTSVFAEMVPDVWFVPGVVLEVTAADISISP
IHTAAYGSVKEDAGLGLRFPRFTGRVRDDKTPEQGTTVGEIREFYDMQEERDADPSDEPG
GEFTD
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcgatatcgcggaggtattcgacaggctcgaacacacgagcagccgtctc
gagatgacggacatactctcggatttcttcaaaagagtggatccccgcgacctgaggcag
atcatctacctctccgtcggaagactgcaccccgacttctacccccaggaactggggatg
gccgacaaactcgtcctcagggccatctccgcggtgtccgggaggccccagtcggaagtc
gaccagctctccatcaggatcggggacccgggagacatcgccgaacagctgatccagaag
aagaagcagatgaccctgttctccgaacccctcacgttcgaggccgtcatcgaggggctc
accgccatcgagaccgcatccggcaaggactcccaggacaggaagatgaaacacctctcc
aggatgctccatgattccgggcccgtcgaggcgaggtacatctgcaggatcgtcaccggc
aggatgagggtcggagcgggttccatgaccgtcatggacgccctcgcatccgctttcgcc
aacaaggaggaccgccccgagatcgagagggccttcaacatcacctgcgatatgggattg
gtggccgagaccctcgccgagggcggactggaagccgtcaggaagatcggcgtcagcgtc
ggcagccccatcagggtcatgctcgccgagaggctccgctccctgccggacatcatcgac
aggatgggcgggaagtgcgccttcgagtacaaatacgacggcatccgtgtccaggcgcac
attaggaagggggatgggggcttcgtcaagctctactcccgcaggctggaggacatgacc
tccaacttcccggacatcgccgaggccttgcagagacagcttaggggcagcgaggcgatc
atcgaaggggagtgcgtcgccatcgacccctccacagacaacctgatgccgttccagaac
gtcacccacagacgcaagaagcacggtatgtcacaggccgtggaggacgtccccgtccgc
atattcatgttcgacctcctgtacctcgacggtacggattacaccctctccccgtatccc
aagaggagggagatcctcgaaggggccttcgacgtcaacacggacccgtccacctacgac
cacgtgggctacaccacccgtgcggtcatcgacaacgacgacgatgcccagaggttcttc
gacaccgcaatcgcctccaaatgcgagggcatcatagccaagtccctggaggacgaatcg
atctaccgcgcaggatccaggggattcctgtggatcaagtacaagaaggactacacccag
gccctcgtcgactccttcgacctcaccgtcgtcggtgcgttctacggcatggggaagaga
gccggggtatacggtgcgctgcttatggcggcatatgacccagacaccggaaagttctgc
accacctgcaagctcgggaccggtttcgacgatgccttcctcgcatccctgccgtccctt
ctggacaggtacaggtccgagtccaagcccacctccgtgttcgccgagatggtccccgac
gtatggttcgtccccggagtggtactcgaggtcaccgccgcggacatcagcatcagcccc
atccacaccgccgcctacggctccgtcaaggaggatgccggcctcggactgaggttcccc
aggttcaccggcagggtgagggatgacaagacccccgaacagggaaccaccgtcggcgag
atacgcgagttctacgacatgcaggaggagagggacgccgacccctccgacgaacctggc
ggcgaattcacggactga

DBGET integrated database retrieval system