KEGG   Thermoplasmatales archaeon BRNA1: TALC_01166Help
Entry
TALC_01166        CDS       T02532                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase-related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tar  Thermoplasmatales archaeon BRNA1
Pathway
tar00010  Glycolysis / Gluconeogenesis
tar00020  Citrate cycle (TCA cycle)
tar00620  Pyruvate metabolism
tar00640  Propanoate metabolism
tar00650  Butanoate metabolism
tar00680  Methane metabolism
tar00720  Carbon fixation pathways in prokaryotes
tar01100  Metabolic pathways
tar01110  Biosynthesis of secondary metabolites
tar01120  Microbial metabolism in diverse environments
tar01130  Biosynthesis of antibiotics
tar01200  Carbon metabolism
Module
tar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TALC_01166
   00020 Citrate cycle (TCA cycle)
    TALC_01166
   00620 Pyruvate metabolism
    TALC_01166
   00640 Propanoate metabolism
    TALC_01166
   00650 Butanoate metabolism
    TALC_01166
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TALC_01166
   00680 Methane metabolism
    TALC_01166
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TALC_01166
Enzymes [BR:tar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TALC_01166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AGI48154
UniProt: M4YLU2
LinkDB All DBs
Position
complement(1072066..1073241)
Genome map
AA seq 391 aa AA seqDB search
MSSKVGTDIAINGDGAVALAWKQINPDVVAAYPITPQTIIVEDFSKYVANGEVDTEFIDV
ESEHSALTLCSTSSSAGARTFTATASQGLAYMWEMLPITAAMRVPVMMAVANRTVSGPIN
INNDHGDVMSARDTGWLSIFAENVQEAYDMSIIGPRIAEHHEVQLPILVNLDGFILTHAI
ERMTPLDTQHVRDFVGEFKPLYPLLDTDHPVTHNLMDGPLFYFPHKYQMVVAMNKALDVA
REVFAEFAKISGREYHMVEEYRCDDADYIAIVLGSSFGTMKQAVDNLRDEGMKVGVAMPR
VYRPWPADEIAALCKGKKAVIVMDRHLSIGAYGPMFPEVCASIAVNGKMPEMYNFIYGLG
GADTMVSDFMSVYKTVEAGKANTINYLGVKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaggtcggaaccgacatcgcaatcaacggagacggagcggtcgccctcgca
tggaagcagatcaaccccgacgtcgtcgcagcttaccccatcacccctcagaccatcatc
gtcgaggacttctccaagtacgtcgccaacggagaggtggacaccgagttcatcgacgtg
gagtccgagcactccgcgctcaccctctgctccacctccagctccgcaggggcaaggacc
ttcaccgcaaccgcgtcccagggtctcgcctacatgtgggagatgctccccatcaccgcc
gccatgcgcgtcccggtcatgatggccgtcgccaacaggaccgtctccggacccatcaac
atcaacaacgaccacggggacgtcatgtccgcaagggacaccggatggctctccatcttc
gcggagaacgtccaggaggcctatgacatgagcatcatcggccccaggatcgcagagcac
cacgaggtccagctgcccatccttgtcaacctagacggattcatcctgacccatgccatc
gagaggatgacccccctcgacacccagcatgtcagggacttcgtcggcgagttcaagccg
ctgtaccccctgctcgacaccgaccaccccgtcacccacaacctgatggacggtccgctg
ttctacttcccccacaagtaccagatggtcgtcgccatgaacaaggcgctcgacgtcgca
agggaggtattcgccgagttcgccaagatctccggaagggagtaccacatggtcgaggag
taccgctgtgacgacgcggactacatcgccatcgtcctcggatccagcttcggaaccatg
aagcaggccgtcgacaacctccgcgacgagggaatgaaggtcggagtcgccatgcccagg
gtctaccgcccctggcccgccgacgagatcgccgccctctgcaagggaaagaaggccgtc
atcgtcatggacaggcacctcagcatcggagcctacggccccatgttccccgaggtctgt
gcatccatcgccgtcaacggcaagatgcccgagatgtacaacttcatctacggactcgga
ggagccgacaccatggtgtccgacttcatgtccgtgtacaagaccgtcgaggcgggcaag
gcaaacaccatcaactatctgggggtgaaggaatga

DBGET integrated database retrieval system