KEGG   Taylorella asinigenitalis MCE3: TASI_0723Help
Entry
TASI_0723         CDS       T01634                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00473  D-Alanine metabolism
tas01100  Metabolic pathways
tas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TASI_0723
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TASI_0723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tas01011]
    TASI_0723
Enzymes [BR:tas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TASI_0723
Peptidoglycan biosynthesis and degradation proteins [BR:tas01011]
 Precursor biosynthesis
  Racemase
   TASI_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEP36494
UniProt: G4Q9F7
LinkDB All DBs
Position
729749..730981
Genome map
AA seq 410 aa AA seqDB search
MKFPLKSLTIIIASLFAAQSNSAPVLSTDDVKVSQLSEFSANAWIEVDVHAFENNIAELQ
RLLNGKSKVCAILKADAYGHGINLIMPSIIKMNVPCIGIASNEEARIARAHKYEGTIMRV
RAASINEIKDGLKYDMEELVGDVTQAQTINDLAKEAGKDVRIHISLNSAGMDRNGIDMTT
EKGRSEALELTKFSNLKVVGIMTHYPEEDEEVIRKDLARFNEDTKWLIENAGLKRDQIVL
HTANSYTTLTVPEAHFDMVRPGGLLYGDSIPTRTEYKRIFSFKSRVANINHYPKGSTVGY
DRTFTLERDSMLANLPFGYSDGYRRVFSNKGYVLINGHKVPVVGRVSMNTTMVDVTDFPD
ILEGDEVVIFGTQGDAKVEQSDIEEMNGALLADLYTVWGNSNPRIVKPTN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcccacttaaatcattaacaattattattgcttcactttttgctgctcaaagt
aactctgctcctgtactaagtacggatgatgtgaaggttagtcaattgtcagagttctct
gctaatgcgtggatagaggttgatgttcatgccttcgaaaacaatattgctgaactccaa
agattactaaatggtaaatctaaagtttgtgcaattctaaaagctgatgcatacggacat
ggtattaatcttataatgccgagtatcataaaaatgaatgtaccatgcataggcattgcc
agcaatgaggaagccagaattgcaagagcccataaatatgaaggtaccattatgcgtgtg
agggcggcttctattaatgaaatcaaagatggtcttaaatatgatatggaagagcttgta
ggtgatgtgacgcaggctcagaccattaatgatttggctaaggaagcaggtaaagatgtg
cgaattcatatatctttaaattctgctggtatggatagaaacggtattgacatgactact
gaaaagggcaggtcagaggcactggaacttacaaagttctctaatttaaaggtagttgga
attatgacccattatccagaagaggatgaagaagtaattcgtaaagatttggctcgattt
aatgaagacactaaatggcttattgaaaatgctggtttaaaacgtgaccaaattgtctta
cacaccgcaaattcttatactactttaactgtacctgaagctcattttgatatggtgagg
cctggtggcttactatatggtgattctatacctacgagaactgaatataaacgcattttc
tcgtttaaatcgagggtcgctaatatcaatcattatccaaaaggctctaccgttgggtat
gacagaacattcactttagaaagagattctatgttagcaaatctgccgtttgggtattcg
gatggttatagaagggtgttttcaaataagggttatgtattaattaatggtcataaggtt
ccagttgtgggcagagtttctatgaatacaactatggtggatgtcacagatttccctgat
attttagagggtgatgaggtagtgatatttggaactcaaggtgatgcgaaagttgagcaa
tccgatatagaagagatgaatggtgctttattggcagacctttacactgtgtgggggaat
tcaaatccaaggatagtgaaaccaaccaactaa

DBGET integrated database retrieval system