KEGG   Taylorella asinigenitalis MCE3: TASI_1280Help
Entry
TASI_1280         CDS       T01634                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00473  D-Alanine metabolism
tas00550  Peptidoglycan biosynthesis
tas01100  Metabolic pathways
tas01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TASI_1280
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TASI_1280
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TASI_1280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tas01011]
    TASI_1280
Enzymes [BR:tas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TASI_1280
Peptidoglycan biosynthesis and degradation proteins [BR:tas01011]
 Precursor biosynthesis
  Amino acid ligase
   TASI_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST GARS_A ATP-grasp_4 RimK TTL ATPgrasp_YheCD ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEP37023
UniProt: G4QC54
LinkDB All DBs
Position
complement(1322738..1323676)
Genome map
AA seq 312 aa AA seqDB search
MIKKPRVVVLYGGTSAEREVSLMSGRGVFDALVSRGYDVELFDIATQAIENIKAYDVAFI
ALHGRYGEDGCIQGLLELLKVPYTGPGVMSSSIGMNKIISKKIFIDEGLPTPDYMVVKSY
EELKKAAVSLGYPIIVKPPQEGSTIGLVKVESDEMLESAFNESGQYDGELLVEKCIEGRE
LTVAILGKQPNTKALPLVEIITPDGNYDYDQKYNRDDTKYISPAQIDPKLTEEIQDICIK
AYDALECEGWSRVDVMLDGRNKPWILEINTSPGMTSHSLVPLAAKAQGMEYADICEEILK
SASLKIKSVCKG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagcctagagttgttgttttgtatggtggtacctcagcagaaagagaagtc
tctctaatgtctggcagaggcgttttcgatgcactcgtatctcgtggctatgatgtggaa
ctattcgatattgccacccaagctattgaaaatataaaagcctatgatgtggcgtttatc
gctttgcatggtagatatggtgaagacggttgtattcagggacttttagaattacttaaa
gttccatacactggcccaggtgtgatgagttcttctattggtatgaataaaatcataagc
aagaaaatttttatagatgaaggcttgcccactccagactatatggtcgtaaaaagttac
gaggaacttaaaaaagctgccgtaagcttaggatatcccattatcgttaagccaccacaa
gaaggttcaactattggcttggtgaaggtagaatcagacgaaatgttggaatctgccttc
aatgagtcagggcaatatgatggtgagctattggttgaaaaatgtattgaaggaagagag
ttaactgttgcaatactaggaaagcagccgaatacgaaggcattgccactagtagagata
attactccagacggaaattatgactacgaccaaaaatacaatcgagacgatacaaagtac
ataagtccagcacaaatagatccaaaacttacagaagaaattcaagacatatgtattaag
gcttatgatgctcttgaatgtgagggatggtctagagtggatgttatgttagatgggcga
aataagccatggattttagaaataaatacttcaccaggtatgacctctcattcattagtg
ccattagcggcaaaggctcagggcatggaatatgcggatatttgtgaggaaattttgaaa
tcagctagtctaaaaattaagtctgtatgtaaggggtaa

DBGET integrated database retrieval system