KEGG   Taylorella asinigenitalis 14/45: KUM_0093Help
Entry
KUM_0093          CDS       T02603                                 

Gene name
fabZ
Definition
(GenBank) (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tat  Taylorella asinigenitalis 14/45
Pathway
tat00061  Fatty acid biosynthesis
tat00780  Biotin metabolism
tat01100  Metabolic pathways
tat01212  Fatty acid metabolism
Module
tat_M00083  Fatty acid biosynthesis, elongation
tat_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KUM_0093 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KUM_0093 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tat01004]
    KUM_0093 (fabZ)
Enzymes [BR:tat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KUM_0093 (fabZ)
Lipid biosynthesis proteins [BR:tat01004]
 Fatty acid synthase
  Component type
   KUM_0093 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: CCG18899
UniProt: I7JQR9
LinkDB All DBs
Position
complement(93883..94353)
Genome map
AA seq 156 aa AA seqDB search
MSDENVMQLDIQEIMSRIPHRYPMLLVDRVLEMIPAKRIVAIKNVTINEPFFTGHFPDMP
VMPGVFIIEAMAQCAAIFSFAKPNSSVVEKQEEIYYLVGVDETRFRKPVVPGDQLRFEVD
AIRISKVMCKYDAKAYVDDQLVAEAKLMCAVRKVTE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaaaatgtaatgcaattggatattcaagaaattatgtcgaggattccgcac
aggtaccctatgcttttagttgatagggttctcgaaatgatacctgcgaaaagaattgtc
gctattaagaatgtaactattaatgagcctttttttactggccattttcctgatatgcct
gttatgccaggagtattcataattgaagctatggctcaatgtgcagctatattttctttt
gcaaaacctaattccagtgtagttgaaaaacaagaagaaatatattacctagttggagtt
gatgaaacacgttttcgtaaaccagttgttccaggtgatcaattaagatttgaggtagat
gccattcgcatatctaaagttatgtgtaagtatgacgcaaaagcttatgttgatgaccaa
ttagtcgctgaagcaaaattgatgtgtgctgttagaaaagtaacagaatag

DBGET integrated database retrieval system