KEGG   Taylorella asinigenitalis 14/45: KUM_0834Help
Entry
KUM_0834          CDS       T02603                                 

Definition
(GenBank) Type II restriction endonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
tat  Taylorella asinigenitalis 14/45
Brite
KEGG Orthology (KO) [BR:tat00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:tat02048]
    KUM_0834
Enzymes [BR:tat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     KUM_0834
Prokaryotic defense system [BR:tat02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    KUM_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Amidase_3 SHMT
Motif
Other DBs
NCBI-ProteinID: CCG19626
UniProt: I7J1N6
LinkDB All DBs
Position
879745..880626
Genome map
AA seq 293 aa AA seqDB search
MRDFDEWFKTLQYGVTDYSYFIDFDKVYENVEQWKPELHLINSLVGSKNIEEDFIKLVKK
YPKVLECIPVLLAVRLKRNKNGYSEPIVIYDGGKNIEFDFSAKNFSSEIYLKFMDKTGLF
ELLSNRIISNVVDYVTGVETGLNSNARKNRSGALMETKVEKILIENGFVENSTYFKQMSD
KKISDKWKIDLSSITNNGINPKKFDFVIFTNNKVFAVEVNYYGKSGSKPNETARSYKFIA
DASKNIENFQFVWITDGPGWRSSTSKLMDTFANSDHVYNLKDLESGGVKKIFS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttgatgaatggtttaaaactttacagtatggagttactgattattcttac
tttatagatttcgataaagtttatgaaaatgttgaacaatggaaacctgaactacatctg
atcaattcgcttgttggttctaaaaatatagaagaggattttataaaactcgtaaaaaaa
tatccaaaagttttggaatgtattcctgttttattagctgttaggttaaaaagaaacaag
aatggttattcagaacctatagtaatttatgacggaggtaaaaatatagaatttgatttt
tctgcaaagaatttttcaagtgaaatctatttgaaatttatggataaaacaggtttattt
gaacttttatcaaatagaataatcagcaatgtagtggactacgtaactggagttgaaact
ggtttaaatagtaatgctagaaaaaatagatctggtgccttgatggaaactaaagtagaa
aaaattcttattgaaaatggttttgtggaaaattctacgtatttcaagcaaatgtcagac
aagaaaatttctgataaatggaaaattgatttaagttcaattaccaataacggaataaat
cctaaaaagtttgattttgttatattcaccaataataaagtctttgccgttgaagttaac
tattatggtaagtcaggcagcaaacctaatgagacagcgagaagctataagttcattgca
gatgcttctaagaacattgaaaactttcaatttgtatggataacagacggacctggatgg
agaagttctacatcaaagttaatggatacatttgcaaatagtgatcatgtctataacctt
aaagacctagagtctggcggagttaaaaaaatattttcttaa

DBGET integrated database retrieval system