KEGG   Tolumonas auensis: Tola_0067Help
Entry
Tola_0067         CDS       T00904                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tau  Tolumonas auensis
Pathway
tau00564  Glycerophospholipid metabolism
tau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tola_0067
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tola_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N GIDA FAD_oxidored FAD_binding_3 K_oxygenase STPPase_N Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACQ91697
UniProt: C4L7C1
LinkDB All DBs
Position
complement(89950..91491)
Genome map
AA seq 513 aa AA seqDB search
MMNTIPHYDLVVIGGGINGTGIAADAAGRGLSVALFEADDLASATSSASSKLIHGGLRYL
EHYEFRLVKEALAERETLLRMAPHIAHPMRFRLPHRPHLRPAWMIRAGLFLYDHLAKRVT
LPACSSIKFSPNDGVQPHLVKGFEYSDAWVDDARLVVLNAMQARNHGARVDTRTACVKAR
REKEHWQLTLQDQLNGNTFEVTANALVNATGPWVKRLFDEAMELKSPRNIRLVKGSHIIV
PRIHEREEAYILQNEDKRIVFVIPYQQHFSLIGTTDLEYKGDLRAVKINEEEVQYLCDVV
NKHFIHQIAPKDVVWSYSGVRPLCDDESSSPQAVTRDYTLELADEQGKAPLLSVFGGKLT
TYRKLAQAACHKLAPYFPQAREDWTATSKLPGADFEGNVLHLTQKYRKQAPWLDAATARR
IASCYGSLAAGWLPKELTLNFGSELCREEVDYLMEQEWACSAEDILWRRTKLGLTLSDAA
QAQLKAYVAQRMAVRCGKPVTQIKENIEETSAA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaccattccgcattacgatttggtcgtcattggtggaggaatcaatggcacc
ggcattgccgccgatgctgccgggcgcggactttctgttgctctgttcgaggcggatgat
ctggccagtgctacatcgtcggcttccagcaagctgatccacggcggtttacgttatctg
gaacactacgaattccgactggtcaaagaagcactggcggaacgtgaaaccttgctgcgc
atggccccgcatattgcccatccaatgcgttttcgcctgccacaccgccctcacctgcgc
ccggcatggatgatccgcgccggtttgttcctttacgatcatctggcaaaacgcgtgacc
ttacctgcctgcagcagtatcaaattttcacccaatgatggcgtacagccgcatttggta
aaaggctttgaatactccgacgcctgggtggatgacgcgcgtttagtggtgctgaatgcc
atgcaggcacgaaaccatggtgcacgggttgatacccgtactgcctgcgtcaaagcccgt
cgtgaaaaagaacactggcagctgacgctgcaggatcagctgaacggcaatacctttgag
gtcaccgccaatgcactggtgaatgcgaccggtccgtgggtcaaacgtctgtttgatgaa
gcgatggaactgaaatcaccgcgcaacatccggctggtgaagggcagccacattattgtg
ccgcgcattcatgaacgcgaagaagcctatattctgcagaatgaagataagcgcatcgtg
tttgtcatcccctatcagcaacacttctcgctgattggtaccacggatctggaatacaaa
ggtgatctgcgggcagtgaaaattaatgaggaagaggtgcagtacctgtgcgatgtggtg
aataaacatttcatccaccagatagcaccgaaagatgtggtctggagttactccggcgta
cgtccgctgtgtgatgatgaatccagttctccgcaggcggtcacccgcgattacacgctg
gaactggctgatgaacagggcaaggcaccgctgttgtcggtgttcggtggcaagctgacc
acttaccgcaaactggcacaggccgcttgtcataaactggcgccttatttcccgcaggca
cgggaggactggaccgcaacctcgaaactgccgggtgctgattttgaagggaacgtgctg
catctgacccagaagtaccgcaaacaggcaccgtggctggatgccgcaaccgcccgccgg
atcgccagttgttacggtagcctggctgctggctggttgccgaaagagctgacgctcaac
tttggcagtgaattatgccgcgaagaagtggattacctgatggaacaggaatgggcctgc
agtgcggaagatattctgtggcgccgcactaaactcggcctgaccctgagtgacgctgca
caggcgcaactgaaagcctatgtagcacaacgcatggcagtgcgttgcggtaaaccagta
acgcaaataaaagagaacatcgaagaaacatcagccgcctga

DBGET integrated database retrieval system