KEGG   Tolumonas auensis: Tola_0092Help
Entry
Tola_0092         CDS       T00904                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tau  Tolumonas auensis
Pathway
tau00620  Pyruvate metabolism
tau00680  Methane metabolism
tau01100  Metabolic pathways
tau01120  Microbial metabolism in diverse environments
tau01200  Carbon metabolism
Module
tau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tola_0092
  09102 Energy metabolism
   00680 Methane metabolism
    Tola_0092
Enzymes [BR:tau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tola_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACQ91722
UniProt: C4L7S3
LinkDB All DBs
Position
complement(114313..116946)
Genome map
AA seq 877 aa AA seqDB search
MNDMYAALRGNVGMLGHLLGKTIKEHLGDEFLDKIENIRQLAKSSRQGNEEDRQKLITTL
KNLSDDELLPVARAFSQFLNLANVAEQFHSMSRQGELHTTLDPLDSLFDKLKNANLSEQE
IIDTVCELDIELVLTAHPTEVTRRTLIHKHVQLNECLEELELQDLTPRECKFIQHRIEQL
VNQSWHTNEIREQRPTPVDEAKWGFAVIENNLWPAIPLFLRQLDDRLQENFGIRLPLRAH
PVRIASWMGGDRDGNPFVTAKVTQEVLLLSRWVAINLFLTDIQELVSELSMTDCNEELRQ
RVGECSEPYRAILRVVRDSLRETQQAVTAKLQGQYTENRDLITRTEQLREPLELCYRSLQ
SCGMSIIADGMLLDVLRKLACFGVNLLKLDIRQDGERHGQVLSELTQYLELGDYAEWRET
EKQEFLLKELASRRPLLPANWQPSAESQEVVDTCRVIAQTDPDAFGIYIISMARQPSDVL
AVQLLLKEVGCKFHMPIAPLFETQNDLQNAAAVLNRLLSVEWYRNYIRGQQYVMIGYSDS
AKDAGMMSAGWAQYRAMEDLVAIAEREDLKLTLFHGRGGTIGRGGGPAHQAILSQPPGSL
KGGFRVTEQGEMIRFKFGLPEVAIHNFKLYTSAVLEANLLPPPKPEAAWYDVMDKLSEIS
CQHYRSIVRDEPDFVPYFRAATPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQN
RLMLPSWLGAHVALQAVMDEGKEDLLKEMDQQWPFFHTRLEMLEMVFLKADLWLAEYYDL
RLAPENLWPLGKRLRQELQDSINVVLQLLPKRGELLDDQPWIKESIKLRNPYTDPLNVLQ
VELLHRSRATPDEVNPQVDQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatatgtacgcggcgttgcgcggtaatgttggcatgcttggccatctactgggc
aaaaccatcaaggagcatcttggcgatgagtttctcgacaagatagaaaatattcgtcag
ctggctaaatcgtcccgtcagggtaacgaagaagacagacaaaaactgataactacatta
aagaacctgagtgatgacgaattattacctgtcgcgcgtgcattcagccaatttctgaat
ctggccaacgtagcagaacaatttcactcgatgtcacgtcagggtgaactgcatacgact
ctggatccattggatagcctgttcgataaattaaaaaatgccaatttatccgaacaggaa
atcattgataccgtctgcgaactggatattgaactggtactgactgcgcatccgactgaa
gtcacccgccggaccctgatccacaaacacgttcagctgaacgaatgtctggaagagctg
gagctgcaggatctgacgccgcgtgaatgcaaatttatccagcaccgcattgaacagctg
gtaaaccagtcatggcataccaatgaaattcgcgagcagcgcccgacaccggttgatgaa
gccaaatggggctttgcggttatcgagaataacctgtggcctgccataccgttattcctg
cgtcagctggatgatcgtttgcaggaaaactttggtatccgcttaccgctgcgtgcgcat
cctgtccgtattgcatcctggatgggtggtgaccgtgacggtaacccgttcgtgaccgca
aaagtgacccaggaagtgctgctgctttcccgctgggtggcgatcaacctgttcctgacc
gatattcaggagctggtatctgaactgtcgatgaccgactgtaatgaagaactgcgtcag
cgcgtcggcgaatgcagcgagccttatcgcgcgatcctgcgtgtcgttcgtgattcactg
cgcgaaacgcaacaggcggtcaccgcgaagctgcaaggtcagtacaccgaaaaccgcgat
ttgatcacccgcaccgaacaactgcgcgaacctctggagctgtgctaccgctctctgcag
tcctgcggcatgagcatcattgcggatggcatgttgctggatgtgctgcgcaagctggcc
tgcttcggcgttaatctgctgaaactggatatccgtcaggatggcgagcgtcatggtcag
gtgttgtctgagctgacccagtatctggaactgggcgattacgcagaatggcgcgaaacc
gagaagcaagagttcctgctgaaagaactggcctcccgtcgtccgttactgccggccaac
tggcagccaagtgccgaatcacaggaagttgttgatacctgccgcgtgattgcacaaacc
gatccggatgcctttggtatctacattatttctatggcgcgtcagccatccgacgtatta
gcggtgcaattactgctgaaagaagtcggctgtaaattccatatgccgattgcgccactg
ttcgaaacccagaatgacctgcagaatgcggccgctgtattgaaccgtctgctgtctgtt
gaatggtaccgtaattacatccgcggtcagcaatatgtgatgatcggttactctgactcg
gcgaaagatgccggcatgatgtcagcgggctgggcacaatatcgcgcgatggaagatctg
gtcgccattgcagaacgtgaagatctcaaactgacgctgttccatggtcgtggcggcact
atcggccgtggcggcggaccagcacatcaggcgattttgtctcagcctccgggatcactg
aaaggtggtttccgtgtcactgaacagggcgaaatgatccgcttcaagtttggtttgccg
gaagtggcgattcataacttcaagctctataccagtgcggtactggaagcgaacctgctg
ccaccgccgaaaccggaagcagcgtggtatgacgtcatggataagctgtcagaaatttcc
tgccagcattatcgcagtatcgtccgtgatgaacctgactttgtaccttacttccgtgcc
gctacgccggaaatggaattgggcaaactgccgctgggttcacgtccatccaaacgtaag
ccgaatggtggcgttgaatcgctacgtgccattccgtggatcttcgcctggacacagaac
cgtctgatgctgccatcctggctgggtgctcatgtggcgctgcaggcagtgatggatgaa
ggtaaagaagacctgctgaaagagatggatcagcaatggccattcttccatacccgtctg
gaaatgctggaaatggtattcctgaaagcggatctgtggctggctgaatactatgacctg
cgtctggcacctgaaaacctgtggccgttaggcaaacggttacgtcaggaattgcaggac
tccatcaatgtggtgctgcaactgctgcctaaacgcggtgagttactggatgatcagcca
tggatcaaagaatccatcaagttgcgtaatccctacaccgacccgctgaacgtactgcag
gttgaactgctgcatcgttcacgtgcgacaccggatgaagtgaatccgcaggttgaccag
gcattaatggtgaccattgccggtattgcagccggtatgcgcaatacgggttag

DBGET integrated database retrieval system