KEGG   Tolumonas auensis: Tola_0792Help
Entry
Tola_0792         CDS       T00904                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
tau  Tolumonas auensis
Pathway
tau00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tola_0792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tau01003]
    Tola_0792
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tau01011]
    Tola_0792
Enzymes [BR:tau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Tola_0792
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Tola_0792
Glycosyltransferases [BR:tau01003]
 Polysaccharide
  Bacterial polysaccharide
   Tola_0792
Peptidoglycan biosynthesis and degradation proteins [BR:tau01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Tola_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACQ92420
UniProt: C4LBI5
LinkDB All DBs
Position
865806..868109
Genome map
AA seq 767 aa AA seqDB search
MAKKPTKKSTPVYPFWHWRRWIGLAIKLGLVGIAFMVLFGIYLDSLIHSKFDSGQKWQLP
AVVYSRPLELFPGQRLSLQQMLHELKLLNYRESSNPKGPGQYAVNGQRMVVIRRSFNFAD
GTEKARPLLLTFSGQRLANIKNADNQRELGYIRMDPVLLDRLSGEEIEDRILLRINQVPQ
SFANMLLQVEDRDFYNHGGVSLLSIGRAFLANLRAGHTVQGGSTLTQQLAKNYFLTRERS
IWRKVQEAYMAVIIDYRYDKNQILETYMNEIYLGQNFAQGVYGFGLASYFYFGMPLNELE
PDQMALLVTMVRGPSYYDPWRYPERAQQRRDMILRLMLENNQLTPEQFQSYAARPLGLIE
RGQMTYGRTPAFMNLLRRELRQRFGAGFLEQSGLKIFTSLDPVAQQAAEESVSSQLNSIE
KRLNRKSLQGAMVVTNRHSGEVSALVGGRDTSYAGLNRALDARRPIGSQVKPAVYLTALD
QGYQLATPLKDEPLQLRNQGGKTWAPQNYDKTYRGNVPLYAAMANSLNVPTVRLGMAVGV
PAVAETLKKMGVTQDIPLFPSLFLGILELSPYEVNQAYLTLATEGLYQPLTAIRTIQDNS
DKVIYQRAEKAERRLSSQSAYLTLFAMTKVASLGTARSLAAKFPNAVLAGKTGSTDNLRD
AWFTGMDNDEVVTVWVGRDDNKPAGLTGANGALPLFSDYMTRRGVNSLKLPVPQGISMVN
FNLSGKPVASGCGGALMLPARSDKLPPAEGCSSTPVDWIKNMFALGE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
gtggctaagaaaccaacaaagaaaagtacgccggtttatccattctggcactggcgtcgc
tggattggactggcgataaaacttgggctggtagggatcgctttcatggtgctgtttggc
atctatctcgacagtctgatccacagtaaattcgatagcggccagaaatggcagttgccg
gccgtggtctatagccggccactggagctgtttcccggccagcgtttgtcattgcagcag
atgttgcatgagctgaaactgctgaattaccgcgaaagcagcaatccgaaaggaccgggg
cagtatgcggtgaatggccagcggatggtggttatccggcggtcgtttaattttgccgat
ggtacagaaaaagcacggccattactgctgaccttcagcggacaacgtctggcgaatatc
aagaatgcggataaccagcgtgagctcggttatatacgcatggatccggtgctgctggat
cgcctgagtggtgaagagatcgaagaccgtattctgctgcggatcaatcaggtaccgcag
tcgtttgccaatatgctgctgcaggtggaagaccgtgatttttataaccacggcggtgtg
tcgttactttcgattggccgtgcctttctggccaacctgcgggctggtcatacggtacag
ggtggcagtacgctcacacagcagctggctaaaaactacttcctgacccgtgaacgcagc
atctggcgtaaagtgcaggaagcgtacatggcggtgatcattgattatcgctatgacaaa
aaccagatccttgaaacctatatgaacgagatctatctcggtcagaattttgcgcaaggt
gtatatggtttcgggctggcgtcgtatttctatttcggtatgccactcaatgagctggaa
ccggatcagatggccttgctggttactatggttcgcggtccttcttattatgacccatgg
cgttatccggaacgggcacagcagcgacgtgacatgatcctgcgactgatgctggaaaat
aatcagctgacaccggagcagttccagagttatgccgcacgtccgttaggtttgattgaa
cgcgggcagatgacctatggccgcacgccggcctttatgaatctgctgcgccgtgaactg
cgccagcgtttcggtgccggtttccttgaacagtctggtctgaaaattttcaccagtctt
gatccggtcgcacaacaggcggcggaagagtccgtttcttcccagctgaacagtatcgaa
aaacgtctgaaccggaaatcactgcagggtgcgatggtggtaaccaatcgtcattccggt
gaagtctctgcgcttgtcggtggacgtgacaccagttatgccggtttaaaccgtgcgctg
gatgcgcgtcgccctatcggttcacaggttaaacctgcggtgtatctgaccgcacttgat
cagggctatcagctggcaacgccactgaaggatgaaccgctgcagttacgtaatcagggc
ggcaaaacctgggcaccgcaaaactacgataagacctatcgtggcaatgtgccgttatat
gctgccatggcgaattcactgaatgtgccgacggttcgtttaggtatggcggtgggggtc
cctgcggtagcggaaaccctgaaaaagatgggggtgacgcaggatatcccgctcttcccg
tcactgtttctggggatactggaactttctccgtatgaggtgaatcaggcgtatttgacg
ttggcgacagaagggttatatcagccgctgaccgctatccggacgattcaggataacagt
gacaaagtcatttatcagcgtgctgaaaaagctgaacgtcgtttaagcagtcagtcagca
tatctgacgctgttcgcgatgacgaaggtcgccagtctggggactgcgcgcagtctggcg
gcgaaattcccgaatgctgtgctggcgggtaaaacaggttccacggataacctgcgtgat
gcatggtttacgggcatggataacgatgaggtggttacggtctgggtcggacgggatgac
aataagccggctggtttgaccggcgccaatggtgcattgccgctgttcagtgactatatg
actcgccgtggtgtgaattcgctgaaattaccggtgccgcaggggatctctatggtcaac
ttcaacctgagcggtaaacctgttgctagtggttgtggcggtgcactaatgttaccggcc
cgtagcgataaattaccaccggcggagggttgcagtagtacaccggtcgactggattaaa
aacatgttcgcgctaggagaatag

DBGET integrated database retrieval system