KEGG   Treponema azotonutricium: TREAZ_1432Help
Entry
TREAZ_1432        CDS       T01506                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
taz  Treponema azotonutricium
Brite
KEGG Orthology (KO) [BR:taz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:taz03400]
    TREAZ_1432
Enzymes [BR:taz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TREAZ_1432
DNA repair and recombination proteins [BR:taz03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    TREAZ_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: AEF81036
UniProt: F5YF74
LinkDB All DBs
Position
953289..955760
Genome map
AA seq 823 aa AA seqDB search
MKDSHRGFLVHSYVDLRRNRLYLLGRFEDGRSFAAVETRWRPSLHIFEKDLHRCKSLLSA
FNFKIIQATFESFDGKEKLVLLEFSCYADRSSAVKLLEAGAVPSPDSDLKPADAYLMERQ
IKGPVEIAGDSRPGHFVDLVFRDSVLCSPKEKGKKRIPLKLLSIDIETDVKKGTILAVGI
SSFGSNDTASLVRVLAAGESGCEGIIFHPDEKSLLAAFVLDVRKADPDVLTGWNFLDFDY
PRLAERCELNHVPFALGRGQELAKFFPGSQSNSEKSSKDTTEESPWYDRRRSAAALVPGR
QVIDALRVMRSGPRRLSGYTLETAAQEVLGEGKLVAAAGDQKIEELEKLYREDPLRFGAY
CRRDAELVPLILDKAGLFNLTVERASHTGVTLDKAWTSVVSFERIYGMELWGRGIAQPPK
TLGREVSGAAGGTILEPLQGVFPNVAIFDFRSLYPTIMLTFNIDPFAHARAEETGTICAP
NGALFSRSPGILPELIAAYFAERRKALDAGDEEASQVYKILMNSFYGVLGTASCRYGRTE
LAGAITSFARKWLYLSRDWFNAKGYRVLYGDTDSLFVETGLGDKAGNGDFLEFGKALTGE
LNAHLAEKIHEEYGLISHLELRFEKAYRRFMIPPLRNLQYASGISESKGRAKGYGGWVIG
KDGSLTVEVKGMEAVRSDSTPLARRIQMELLELVFSSGTEEDLKKYVFEILRKLRRGELD
DKLIYRKRLARTPETYTSSTPPQVKAARILGWKNRKGTVEYIWTVRGPEPVSMPHAVPDY
DHYMDSQVLPVARSIAAAAGWNTEISPYSKRDRLSDGQMELGL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacagtcacaggggtttcctggttcatagttatgtggatcttcgccggaacagg
ctttaccttttgggccgttttgaggatggccgttcctttgcagcagtggaaacccggtgg
cggccttcgcttcatattttcgaaaaagatctgcaccgatgcaaaagcctgctctctgcc
ttcaatttcaaaattatccaggcaaccttcgaatcttttgacgggaaggaaaagctcgtc
ctcctcgaattttcctgttatgcggatcgatcttctgcggtaaaattgttggaggccggg
gcagtccccagccctgacagcgatctcaagcccgcagatgcttatctcatggaaaggcag
atcaaaggccctgttgagatcgcgggggattcccgccccgggcatttcgtggatttggtt
ttccgcgattccgtcctttgcagccccaaagaaaaggggaaaaaaagaataccgctaaaa
ctgctttccatagatatcgaaactgatgtcaagaaaggaactattcttgctgtgggaatt
tcaagctttggcagcaatgatactgccagccttgtccgggttcttgctgccggggaatct
ggttgtgaaggtattattttccaccctgatgaaaaatcactgcttgcagcatttgtgctg
gatgtcaggaaggctgaccccgatgttttgacaggctggaattttttggactttgattat
ccccgccttgctgaacgctgcgaattgaaccatgtgccttttgccctgggacgggggcag
gaattggcaaagttctttcctggttcacaaagcaattctgaaaaatcttccaaagatacc
acagaagaatccccctggtacgacaggaggagatccgctgccgccctggtcccgggacgc
caggtcatagacgcccttagggtgatgcggtcaggcccccgcagactttcaggatatact
ttggaaactgctgcccaggaagtgctgggcgagggcaagcttgttgcggcagcaggggat
cagaaaatcgaagagcttgaaaaactctaccgcgaagatcccctgcgtttcggcgcttac
tgcaggagggatgcggagcttgtccctcttattttggacaaagccggcctcttcaatttg
actgtggagagggcttcccatacaggtgttactctggataaagcctggaccagcgtggtg
agttttgagcgtatctacggcatggaactgtggggcaggggcattgcccagcctcccaag
actttgggcagggaagtttcgggagctgcgggcggaacaatactggagcctttgcagggt
gtcttccccaatgtggctatttttgatttccgcagcctgtacccgactattatgttgacc
tttaatattgatccttttgcccatgcccgtgctgaagaaaccggtacaatttgcgccccc
aatggggcgttgttttcccgcagtcccggaatactgcctgaattgattgccgcatatttt
gcagagcgcagaaaagcccttgatgcaggggacgaagaagccagccaggtctacaagatc
ctgatgaacagcttttatggcgtccttggaacagcttcctgccgttacggcaggacagag
cttgcgggggctattacgtcctttgccagaaagtggctttatctttcgcgggattggttc
aatgcgaagggctatagagtgctgtacggggatacggattctctctttgtggaaacaggc
ttgggtgataaagcaggcaacggggattttttggaatttgggaaagcccttaccggggaa
ctcaatgcgcaccttgcggaaaaaatacatgaagagtacggtctcatctcgcacctggaa
ctgcgtttcgaaaaggcttaccgccgctttatgataccccctttaaggaatcttcaatat
gcttcgggtatcagcgaaagcaagggcagggcaaaagggtacgggggctgggtcatcggg
aaagatggaagccttacagttgaggtcaaaggcatggaagcagtgaggagcgattctacc
cccctggccagacgcatacagatggaattattggaattggttttttcctcaggcacagag
gaggatcttaaaaaatatgtttttgaaattctaagaaaactccgccggggagaattggat
gataaattgatttaccggaagcgccttgcaaggacgcctgaaacttatacctcatcaacc
cctccccaggtaaaggcagccagaatcctgggctggaaaaaccgcaaagggacagtggaa
tacatttggactgtcagaggccctgaacctgtatccatgccccatgctgtgccggactat
gatcattacatggattcccaggttttgcctgtggcaagatcaattgccgccgctgcgggg
tggaatacggaaatttccccctatagcaaacgggatcgcctgagcgatgggcagatggaa
ctggggctgtga

DBGET integrated database retrieval system