KEGG   Thermococcus barophilus: TERMP_00818Help
Entry
TERMP_00818       CDS       T01377                                 

Definition
(GenBank) ribulose-1-5-bisphosphate carboxylase Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tba  Thermococcus barophilus
Pathway
tba00630  Glyoxylate and dicarboxylate metabolism
tba01100  Metabolic pathways
tba01120  Microbial metabolism in diverse environments
tba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TERMP_00818
Enzymes [BR:tba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TERMP_00818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADT83795
UniProt: F0LLL8
LinkDB All DBs
Position
complement(710009..711343)
Genome map
AA seq 444 aa AA seqDB search
MSEKFDKIYDYYVDKSYEPNKKRDIIAVFRITPAEGYSIEAVAGGVAAESSTGTWTTLYN
WYEEERWADLSAKAYDFHDMGDGSWIVKIAYPFHAFEEANLPGLLASIAGNIFGMRRAKA
LRLEDIYFPEKLIREFDGPAFGMEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLATEL
LMNGADYMKDDENLTSPWYNRFEERAEIIARIIEKVENETGEKKTWFANITANVPEMEER
LEILADLGLKHAMVDVVITGWGALQYIRDLAADYGLAIHGHRAMHAAFTRNKYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARIFRESHYKPDENDVFHLEQKFYHIK
AGFPTSSGGLHPGNLPIVFDALGTDIVIQVGGGTLGHPDGPAAGARAVRQAIDAYMQGIP
LDEYAKTHEELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaatttgacaagatatatgactactatgtggacaagagttatgaaccgaac
aaaaagagggacatcatagcagtgtttcgtataactccggcagaaggttactccatagag
gctgttgcaggtggtgttgctgccgagagctcaactggaacctggacaacgctctacaac
tggtatgaggaggagcgatgggcggacctttctgccaaggcctatgacttccatgacatg
ggcgatggtagctggatagtaaagatagcatatccgttccacgcctttgaggaggccaac
cttccaggacttctcgcgagtatagcaggaaacatttttggaatgaggcgtgccaaggca
cttcgccttgaggatatttacttcccggagaaactcattagggaatttgacgggcctgcc
ttcggtatggaaggcgtcaggaagatgcttgagataaaggacaggccaatctatggtgtc
gttccaaagcccaaggtcggctactctccggaggagttcgagaagctcgctacagagttg
ctcatgaacggtgctgactacatgaaggacgatgaaaacctaacaagcccctggtataat
cgtttcgaagaaagggctgagataatcgcgagaatcatcgagaaagtcgagaacgaaact
ggcgagaagaagacctggttcgccaacataaccgccaacgttcccgagatggaggagagg
cttgaaatcttagcggatctcggcctcaaacatgcgatggttgatgttgtcataaccgga
tggggagcactgcagtacatccgtgatttggcagctgactacggcttggctatccacggc
cacagagcgatgcacgctgcctttacgaggaacaagtaccacggcatctcgatgttcgtc
cttgccaagctctacaggctcataggcatagaccagctccatgtcggaacggctggagcg
gggaagcttgagggaggaaaatgggatgttattcagaatgcaaggatattcagggaaagc
cactacaagcccgatgaaaacgatgtcttccaccttgagcagaagttctatcatataaaa
gcaggattcccgaccagctctggtggattacatccaggcaacttgccgatagtctttgat
gctcttggaactgatatagttattcaagttggtggaggaacccttggtcacccagacggg
ccagcagcaggagcaagggcagtccggcaggcaatcgatgcctacatgcagggaattccg
cttgatgagtatgcaaagactcatgaggagcttgcaagagctctggaaaagtggggccat
gtgactccagtttga

DBGET integrated database retrieval system